KEGG   Chryseobacterium arthrosphaerae: EGY05_07810Help
Entry
EGY05_07810       CDS       T05746                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
carh  Chryseobacterium arthrosphaerae
Pathway
carh00071  Fatty acid degradation
carh00280  Valine, leucine and isoleucine degradation
carh00281  Geraniol degradation
carh00362  Benzoate degradation
carh00592  alpha-Linolenic acid metabolism
carh01100  Metabolic pathways
carh01110  Biosynthesis of secondary metabolites
carh01120  Microbial metabolism in diverse environments
carh01130  Biosynthesis of antibiotics
carh01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:carh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EGY05_07810
   00592 alpha-Linolenic acid metabolism
    EGY05_07810
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EGY05_07810
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    EGY05_07810
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EGY05_07810
   00642 Ethylbenzene degradation
    EGY05_07810
Enzymes [BR:carh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     EGY05_07810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Sigma70_r4 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AYZ11832
LinkDB All DBs
Position
complement(1707641..1708819)
Genome map
AA seq 392 aa AA seqDB search
MKTAYIVKGFRSAVGKAPKGSLRFTRPDVMAATVIEKLMAELPQLDKNRIDDLIVGNAMP
EAEQGLNVARLISLMGLNTDKVPGVTVNRYCASGSEAIAIASAKIQAGMADCIIAGGTES
MSYIPMGGYKPVPETDIAKTNPDYYWGMGYTAEEVAKQYNISREEQDQFAFESHMKALKA
NQEGKFANQIVPIPVEYNFLDENQKMQTKKFDFSVDEGPRADTSLAGLAKLRPVFANGGS
VTAGNSSQMSDGAAFVMVMSEEMVKELGLEPEARLVAYAAAGLEPRIMGMGPIYAIPKAL
KQAGLELKDIDLIELNEAFASQSVAIKKELGLNPEILNVNGGAIALGHPLGCTGTKLTVQ
LLDEMRRRGNKYGMVSMCVGTGQGAASIFELL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcatacatcgtaaaaggattcagatcagcagtaggaaaagcaccaaaaggt
tctctgcgctttacacgtcctgacgtaatggcggctaccgtgattgaaaaattaatggct
gagcttccgcaattagataaaaacagaattgatgaccttattgtaggaaatgcaatgcct
gaggccgagcaagggttaaatgtagcccgtctgatctccttaatgggattaaatacagat
aaagttccgggagtaaccgtaaacagatattgtgcatcaggaagtgaggctattgctatt
gcttctgcaaaaatacaggcgggaatggcagattgtatcattgccggaggtactgagtcc
atgtcttatattccgatgggtggttataagccggttcccgaaacggatattgcaaaaacc
aaccctgactattattggggaatgggttatactgctgaagaagtagcgaaacaatacaat
atttcaagagaggaacaggatcagtttgcttttgaatctcatatgaaagctttaaaggct
aatcaggaaggaaaatttgccaatcagatcgttccgattcctgtagaatataatttcctg
gatgaaaaccagaaaatgcagactaaaaagtttgatttctctgttgatgaaggaccaaga
gctgatacttcactggctggtctcgcaaaactcagacctgtatttgccaatggaggaagt
gtaacagccggaaactcttctcagatgagtgacggagcggctttcgtcatggtcatgagt
gaggaaatggtaaaagagttaggtcttgaaccggaagcaagattagtagcttatgctgct
gcaggtcttgaaccgagaattatgggtatgggaccgatctatgctattccaaaagcattg
aaacaggccggattagaattaaaggatattgatttgatcgagcttaatgaagctttcgca
tctcaatcagtagcaatcaaaaaagaactgggtttaaatcctgagattctaaatgtaaac
gggggggcaattgctctaggtcacccactgggctgtacaggaacaaaactgacagttcag
cttctggatgaaatgagaagacgtggaaacaaatacggaatggtttctatgtgtgtagga
actggacaaggagcggcaagcatttttgaacttctttaa

DBGET integrated database retrieval system