KEGG   Chryseobacterium arthrosphaerae: EGY05_19215Help
Entry
EGY05_19215       CDS       T05746                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
carh  Chryseobacterium arthrosphaerae
Pathway
carh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:carh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EGY05_19215 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:carh03400]
    EGY05_19215 (ligD)
Enzymes [BR:carh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EGY05_19215 (ligD)
DNA repair and recombination proteins [BR:carh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EGY05_19215 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme Ribosomal_L5e DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AYZ13935
UniProt: A0A3G6BBJ3
LinkDB All DBs
Position
4185524..4187392
Genome map
AA seq 622 aa AA seqDB search
MLARLSEEAFDDKDWVFEIKWDGYRAIADLSRDTPLFYSRNGISFIPKFDKIAQDFKRQK
HQMILDGEVVAYDDQGKPNFQLLQQIGDNPNLALVYQVFDILWLNGHSTEELPLIQRKEL
LKEALVETDVIKYCEHIPEKGIAFFEQMKKMKLEGMIAKRADSLYVENHRTSDWLKIKFS
NTEEVIICGFTEPRGSRKSFGALILGKYIDGELTYCGHTGTGFNAASLQEMYERLRKLVI
KSSPFTDVPKTNMPVTWTKPELVCEIKYSEITKDRIFRHPVFITLREDKEPEEINNSSFN
EKPKVMKAKVSSKKTETSDKEKEITLNKHKVKLTNQDKIYFPKDGITKGDVIEYYQSVAS
YILPHLKNRPLSLNRFPNGIEEQSFYQKDAGEHIPDWIKTTEVYSESNDKNIDYIYCNDK
ATLAYLNNLGCIDMNPWNSSLPDLEHPDYLVLDLDPSTKNSFDEVIETALQVNEVLKAAS
VKGYCKTSGSTGIHIYIPMGGRYDFDQVKDFAHILMKQVNEKIPKITTLERSLQKRDPKK
IYLDYLQNRTGQTLASAYSLRPKQGASVSMPLDWDELKPGLQPTDFNIHNALDRIKEKGD
LFKPVLGKGIDMMKVLEFLQGS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccagactttctgaagaagcatttgatgataaggactgggtttttgaaattaag
tgggacggctacagggctattgcagacctcagccgggatactccccttttttactcccgg
aacggcatttcattcataccgaaatttgacaaaatagctcaggatttcaaacggcaaaag
catcagatgatcctggatggtgaagtggtagcctatgacgatcagggaaagcctaatttt
cagcttttacagcaaatcggggataatcccaatcttgctctcgtttatcaggtttttgac
atcctctggctgaacggccattctacggaagaacttccgcttattcaaagaaaggaactt
ttaaaagaggcactggtggaaaccgatgtcatcaaatactgtgaacatattccggaaaaa
ggtattgcgttttttgagcagatgaaaaaaatgaaactggaaggaatgatcgccaaacgg
gcagatagtctatatgtggaaaatcacagaaccagtgactggcttaaaatcaagttttcc
aatacggaagaagttattatctgcggatttacggagccaagaggttcgaggaaaagtttc
ggagcgttgattcttggaaagtatattgacggggaactgacttattgcggtcatacggga
acagggttcaatgctgcttctttacaggaaatgtacgaaaggctccggaaactggtcatc
aaaagctctccgtttaccgatgttcctaaaacgaatatgcctgtaacctggacaaaacct
gaactggtatgtgaaatcaaatattctgagatcactaaggaccgcatcttccgtcatccg
gtatttataacgctccgtgaggataaagaacctgaagaaattaacaactcatccttcaac
gaaaaacctaaagtaatgaaagctaaagtatcttccaaaaaaacagaaacttccgataaa
gaaaaagagatcactttaaataaacataaagtgaaacttacgaatcaggataagatctat
tttccaaaagatggaatcactaaaggagatgtgattgaatattatcagtctgttgcctct
tatatcttaccccatctgaagaatcgaccgctttctctgaatcgttttcctaacggaatt
gaagaacaaagcttttatcagaaagatgcaggtgaacatattccggattggatcaaaact
acggaggtttactctgaatcgaacgacaaaaatatagactacatctactgcaacgacaag
gcaaccttagcctacctgaataatctaggctgcatcgacatgaatccctggaacagctct
ttaccggatctggaacatccggattatcttgtgttggatctggacccttccactaaaaat
tcttttgatgaagtgattgaaaccgcccttcaggtgaatgaagttttaaaagccgcttca
gtaaaaggctattgtaaaacttccggaagtacaggtattcatatttacattccaatgggc
ggacgttatgattttgaccaggtaaaagattttgcccacattctgatgaaacaggtcaat
gaaaaaataccgaagatcaccaccctggaaaggagccttcaaaaaagagacccaaagaaa
atttatctggattatcttcagaacaggaccgggcaaaccctggccagtgcttatagtttg
cgacctaaacaaggtgcttccgtttccatgccattggattgggacgagctgaagccggga
ttacaacctacagattttaatattcataatgcgctggataggatcaaagaaaaaggagat
ctgtttaaacctgtattaggcaaaggaattgatatgatgaaggtgctggagtttttacag
gggtcataa

DBGET integrated database retrieval system