KEGG   Chryseobacterium arthrosphaerae: EGY05_24175Help
Entry
EGY05_24175       CDS       T05746                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
carh  Chryseobacterium arthrosphaerae
Pathway
carh00564  Glycerophospholipid metabolism
carh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:carh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EGY05_24175
Enzymes [BR:carh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EGY05_24175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA HI0933_like Thi4 Pyr_redox_3 NAD_binding_8 Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AYZ14832
LinkDB All DBs
Position
complement(5302882..5304480)
Genome map
AA seq 532 aa AA seqDB search
MKRNEELSKLTNVKEWDFIVIGGGASGLGSALDAVSRGFKTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGDVGLVKEALKERGLLAKNAAHIVKNQSFIIPNYTWWGGIYYKIGLSVYD
FLAGKLSLGKTKYISKSKTVEKLPTIEQNHLMSGVVYQDGQFDDARLAVNLTQTIIEKGG
TAINYMKVVGLLKNDSGKIIGVTAEDQFNQQQYQIHGNVVINATGVFTNDILNMNNPKHG
KLVVPSQGIHLVLDKSFLKSDDAIMIPKTSDGRVLFVVPWHDRALVGTTDTLLKDESFEP
RALEEEISFVLNTARQYLAKKPTREDVKSVFAGLRPLAAPKDGSKNTKEVSRSHKVITSP
TGLVSIIGGKWTTYRKMAEDTVNEAMKIHRLGNTPSKTEHLSIHGNVKPEQVDRTNHLYV
YGSDIPVIKALQDSNPRYAQKIHPDHPFTVAEVVWAARNEMAETVEDILARRVRLLFLDA
RAAIDSAHHVARIIAEEKGHPEEWAQKQENEFIDLARGYLLTPYSPKVINLN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaacgaagaactcagtaaattaaccaatgtaaaagaatgggactttattgtc
ataggaggaggagccagtggtttaggttcagcattagacgcagtaagcagaggattcaaa
actttattgcttgaatctcatgactttgcgaaagcaacatccagcagaagtaccaaactg
gtacacggcggagtaagatatcttgcccagggagatgtcggtctggtaaaagaagctttg
aaagaaagggggctattggcaaaaaatgcagcccatatcgtaaaaaaccagtctttcatt
attcctaattatacctggtggggtggaatctattataaaataggtttgtctgtctacgac
ttccttgccggaaaactgagtttgggtaagacaaaatatatcagcaaatcaaaaaccgta
gaaaaacttcctactattgaacaaaatcatttgatgagtggtgttgtttaccaggacggg
caattcgacgatgcaagattagcagttaacttaacccagacaattattgaaaaaggagga
actgccatcaattatatgaaagtggtaggacttttaaaaaatgattccggtaagatcatc
ggggttacagccgaagatcagtttaaccagcaacagtatcagattcacggaaatgttgtc
atcaatgcgacaggggtatttaccaatgatattcttaatatgaacaaccctaagcatggc
aaacttgtagtaccaagccagggaattcaccttgtactggataaatccttcctgaaaagc
gacgatgccattatgatcccgaaaacctcagacggcagggttctgtttgttgtcccatgg
catgacagggctttggtaggaactacggatacccttcttaaagatgaaagttttgagccc
cgtgctttggaggaagagatcagtttcgttttaaataccgcaagacagtatctggctaaa
aaaccaacccgtgaggatgtaaaatctgtattcgccggacttcgcccccttgcagctcct
aaagacggaagcaaaaatactaaagaagtttcccgaagtcacaaagtgatcacctctcct
accggactggtttccattatcggaggaaaatggacaacttaccgaaaaatggcagaagac
acggtaaatgaagcaatgaaaattcacaggctgggaaataccccttctaaaacagaacat
ctttctattcatggaaatgtaaagcctgaacaggtagacagaaccaatcatctatacgtt
tacggatctgatatccctgtcatcaaagctttacaggacagcaacccaagatatgcccaa
aagattcatccggaccatccgtttactgtagcagaagttgtatgggctgcaagaaatgaa
atggcagaaaccgttgaggatatcctggcaagaagggtacgtcttttattcctggatgca
agagctgctatagacagcgctcaccatgtagcaagaatcattgctgaagaaaaaggacac
cctgaagaatgggcccaaaaacaggaaaatgaattcatcgatctggcaagaggctattta
ttaacgccttattcacctaaagttatcaacctgaattaa

DBGET integrated database retrieval system