Chitinimonas arctica: FNU76_16420 Help Entry FNU76_16420       CDS       T06695                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cari  Chitinimonas arctica Pathway cari01100   Metabolic pathways cari01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cari00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FNU76_16420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FNU76_16420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDQ27800 UniProt:  A0A516SI29 LinkDB All DBs Position complement(3616306..3616563) Genome browser AA seq 85 aa AA seqDB search MTKQEIFDHLSALLSESFAVDPALIQPAARLYEDLDIDSIDAVDLIGKLKPMLGRRLQAD AFKSAHTLADVVDALHALMNETAGP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccaagcaggaaatattcgatcacctaagcgccttgctcagcgaaagtttcgcggtc gatcccgccctgatccagcccgccgcacgcctgtatgaagatctcgatatcgacagcatc gatgccgtcgatctgatcggcaagctcaagcccatgctgggccgccgcctgcaggccgac gccttcaagtcggcccataccctggccgacgtggtcgatgcgctgcacgccctcatgaac gagaccgccggaccctga

DBGET integrated database retrieval system