KEGG   Cryobacterium arcticum: PA27867_1442Help
Entry
PA27867_1442      CDS       T04435                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cart  Cryobacterium arcticum
Pathway
cart00250  Alanine, aspartate and glutamate metabolism
cart00410  beta-Alanine metabolism
cart00430  Taurine and hypotaurine metabolism
cart00650  Butanoate metabolism
cart01100  Metabolic pathways
cart01110  Biosynthesis of secondary metabolites
cart01120  Microbial metabolism in diverse environments
cart02024  Quorum sensing
Module
cart_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cart00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PA27867_1442
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA27867_1442
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PA27867_1442
   00430 Taurine and hypotaurine metabolism
    PA27867_1442
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA27867_1442
Enzymes [BR:cart01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PA27867_1442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DotU
Motif
Other DBs
NCBI-ProteinID: ANP72399
UniProt: A0A1B1BIG1
LinkDB All DBs
Position
1:1640631..1642007
Genome map
AA seq 458 aa AA seqDB search
MSTNPEFLEVNPLFARPGEATLAPRYTLGDTMMGPDTAFQIIHDEIKLDGISRLNLATFV
STWMDDQARRLYTESFDKNMIDKDEYPQTAAIEDYCWHIIADLWHAPEPRTTIGTSTIGS
SEACMLGGLAFKRRWQQARRAAGLSTEKPNLVMSSAVQVCWEKFCNYWDVEMRLVPVTDE
HPCLDGHDLADYVDENTIGVVAIMGVTYTGIYEPVQEIAAALDEIQTRTGLDVPIHVDAA
SGGMIAPFLQPDLVWDFRLERVHSISTSAHKYGLVYPGLGWVVWRSPDLLPEDLIFRVSY
LGGDMPTLALNFSRPGAQVLLQYYLFLRLGFEGYRLVQQASQDVAMYLSKGIAEHGAFTL
VSDGSDIPVFAWRLAEGHTDKWNLFHLSDRLRARGWLVPAYPMPDDLSDRIVQRIVVRNG
LSLDLASRLLTAISEETAYLDRLDGPMPVEEHQPGFTH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgaatccagagttcctcgaggtcaacccactgttcgcccggccgggggaggcc
acgctcgccccgcgatatacgctcggtgacaccatgatggggccggacacggccttccag
atcatccacgacgagatcaagctcgacggcatctccaggctcaacctggccaccttcgtg
agcacctggatggacgaccaggccagacggctgtacaccgagtccttcgacaagaacatg
atcgacaaggacgagtacccgcagacggcggccatcgaagactactgctggcacatcatc
gccgacctctggcatgcgccagagccgcgcaccaccatcggcacctccacgatcgggtcg
tcggaggcctgcatgctcggcgggctggccttcaagcgccgctggcaacaggcccgtcgc
gctgccgggctctcaacggagaaacccaacctggtgatgagcagtgcggtgcaggtctgc
tgggagaagttctgcaactactgggacgtcgagatgcgtctggtaccggtgacggacgag
catccgtgcctggacggccacgacctggccgactatgtcgacgagaacaccatcggggtc
gtcgccatcatgggagtgacctacacgggcatctacgagccggtgcaagagatcgccgcg
gccctcgacgagatccagacgcgcacgggactggacgttcccatccacgtggatgcggca
tccggcggcatgatcgccccgttcctgcagccggacctggtgtgggacttccggttggag
cgggtgcactcgatcagcacctcggcgcacaagtacggcctggtctacccggggctgggc
tgggtggtctggcgcagccccgacctgctgccggaggacctgatcttccgggtgagctac
ctgggcggcgacatgccgaccctcgcgctcaacttctcgcggcccggagcccaggtgctg
ctgcagtactacctgttcctgcggctcggcttcgagggctaccggctggtgcaacaggcc
tcccaggacgtggcgatgtacctctcgaagggcatcgcagagcacggtgcgttcaccctg
gtgagcgacggttccgacatcccggtgttcgcgtggcggctggccgaggggcacaccgac
aagtggaacctcttccacctgtccgaccggttgcgcgcgcgcggctggctggtgcccgcg
tacccgatgcccgacgacctgtcggaccgcatcgtgcagcgcatcgtggtgcggaacggg
ttgagtctcgacctcgcttcgcggctgctgaccgcgatcagcgaagagaccgcgtacctc
gaccggctggacgggcccatgcccgtggaggaacaccagcccggcttcacccactga

DBGET integrated database retrieval system