KEGG   Cryobacterium arcticum: PA27867_1758Help
Entry
PA27867_1758      CDS       T04435                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cart  Cryobacterium arcticum
Pathway
cart00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cart00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PA27867_1758
Enzymes [BR:cart01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PA27867_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Glyco_hydro_2_C Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: ANP72711
UniProt: A0A1B1BJI9
LinkDB All DBs
Position
1:1982635..1984647
Genome map
AA seq 670 aa AA seqDB search
MTIWYGGDYNPEQWPTNIWDEDVRLMNRAGVSLATVGVFSWARLEPRPGKYDFAWLDGVL
DLLHAHGVRVDLATATASPPPWLALRHPETLPVTEEGVRMSVGSRQQYCPSSPVYRERAR
ELVRRLVERYADHPALELWHVNNEYGCHISHCYCDVSAAAFRDWLRAKYGRIEELNRVWG
TAFWSQRYDSFDEVSPPRAAPTFRNPTQLLDYDRFSNDELLACYRSEVAIIRARSTVPVT
TNFMGFFKAVDYWAWAREVDIVSDDTYPDPADPDSPAYAAMVRDLMRSLGDGAPWLLMEQ
APGAVNWRRRNAAKSPGQMRAWSFQCVARGADGILFFQWRQSAVGSEKFHSGLVPHGGTD
TRVWREVEQLGRELAELSGRTGDAAIVGTRVPSSVAIALDWDSWWAIEQPASPTEVSYVR
TLFAWHSALTSLGLTVDFVRADADLSGYRLVVVPAHFTATDSQVRNLAAVAETGTLVVGF
GTAITDENLHVRLGGYLGEPLRRALGVWIEEFAPPASPDLSNLGAGAPPELVLDGEVFGG
PATGRVWAEYVRVEDAETVATFAEGALSGWPAVTRRGTGAGAGWYVATLPDPGALRRLAE
RIVRDAGLDLPAPAARGDRVETVRRGGYVFVINHGAHEAEVLLDGTDALTGAPALGLKLA
PQGVAVIGVE
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttggtatggcggggactacaaccccgaacagtggccgacgaatatctgggac
gaggacgtgcggctgatgaaccgggcgggcgtctccctcgcgacggtgggagtgttctcc
tgggcccgcctcgagccccgcccgggaaagtacgacttcgcctggctggacggggtgctg
gacctcctgcacgcccacggcgtgcgggtcgacctggccaccgcgacggcatcgccgccg
ccctggcttgccctgcggcatcccgagaccctgccggtgaccgaggagggcgtgcggatg
tcggtgggcagccggcagcagtactgcccgagctcgcccgtgtaccgggagcgagcccga
gaactcgtgcggcgcctggtcgagaggtacgccgaccaccccgccctggagttgtggcac
gtcaacaacgagtacggctgccacatcagccactgctactgcgacgtgtccgccgcggcg
ttccgcgactggctgcgcgcgaagtacggtcggatcgaggaactgaaccgggtctgggga
acggcgttctggtcgcaacggtacgactcgttcgacgaggtctccccgccgcgcgcggcg
cccaccttccgcaaccccacgcaactgctcgactacgacaggttctccaacgacgagctc
ctcgcctgctaccggtcggaggtggcgatcatccgcgcccgctcgacggtgcccgtcacc
acgaacttcatggggttcttcaaggccgtggactactgggcctgggcgcgcgaggtggac
atcgtcagcgacgacacctaccccgaccccgccgaccccgattcgccggcttacgccgcc
atggtccgcgacctcatgcggtccctcggcgacggggcgccgtggctgctgatggagcag
gcgccgggcgccgtcaactggcggcgacggaacgccgccaagtcgcccgggcagatgcgc
gcctggtccttccagtgcgtggccaggggcgccgacggcatcctcttcttccagtggagg
cagtcagcggtcgggtccgagaaattccattccggcctcgtgccgcacggcggaaccgac
acccgcgtgtggcgtgaggtcgaacagctgggccgggaactggcggagttgtccggccgc
acgggagacgcggccatcgtcgggacccgggtgccgtccagcgtggccatcgccctggac
tgggacagctggtgggccatcgaacaaccggcctcccccaccgaggtgtcctatgtccgg
accctgttcgcctggcacagcgccctgacctcgttggggctcacggtggacttcgtccgg
gcggatgccgatctgtccggttaccgcctggtcgtcgtcccggcgcatttcaccgccacc
gacagtcaggtgcggaacctggccgctgtcgccgagacgggcaccctcgtcgtagggttc
ggcaccgccatcacggacgagaacctgcacgtacggctgggcggctacctgggcgaaccg
cttcggcgggccctcggtgtgtggatcgaggagttcgccccgccggcctcccccgacctg
agcaatctgggcgctggggctcctcccgagctcgtcctcgacggcgaggtcttcggcggc
ccggcgaccggccgggtgtgggccgagtacgtgcgggtcgaggatgccgaaaccgtcgcg
accttcgccgagggggcgttgagcggctggccggccgtgacccggcggggaacgggcgcc
ggagccggttggtacgtcgccaccctccccgaccccggggccctgcgccgcctggccgaa
cgaatcgtccgggacgcgggcctcgacctgccggccccggcggcccgcggtgaccgggtg
gaaaccgtgcgccgaggcggctatgtcttcgtgatcaaccacggtgcccacgaggccgaa
gtcctgctcgacggcaccgacgccctcacgggtgcgcccgcgctcgggctgaagctggcc
cctcagggagtggccgtcatcggcgtcgagtga

DBGET integrated database retrieval system