KEGG   Cryobacterium arcticum: PA27867_1837Help
Entry
PA27867_1837      CDS       T04435                                 

Definition
(GenBank) Phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
cart  Cryobacterium arcticum
Pathway
cart00340  Histidine metabolism
cart01100  Metabolic pathways
cart01110  Biosynthesis of secondary metabolites
cart01230  Biosynthesis of amino acids
Module
cart_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cart00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PA27867_1837
Enzymes [BR:cart01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     PA27867_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MukF_M
Motif
Other DBs
NCBI-ProteinID: ANP72790
UniProt: A0A1B1BJN1
LinkDB All DBs
Position
1:complement(2075933..2076196)
Genome map
AA seq 87 aa AA seqDB search
MKTFDALFAELSQKAIDRPEGSGTVRELDAGVHAIGKKIVEEAAEVWMAAEYQSDTETAE
EISQLIYHLQVLMVAKGLSPEDVYRHL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacattcgacgccctgttcgctgagttgagccagaaggccatcgaccgccctgag
ggctccggcaccgtccgcgagctcgacgccggcgtgcacgccatcggcaagaagatcgtc
gaagaggcagccgaagtgtggatggccgccgagtaccagagcgacaccgagactgccgaa
gagatttcgcagctcatctaccacctgcaggtgttgatggtggcgaagggtctttccccc
gaggacgtctaccgacatctctga

DBGET integrated database retrieval system