KEGG   Cryobacterium arcticum: PA27867_2865Help
Entry
PA27867_2865      CDS       T04435                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cart  Cryobacterium arcticum
Pathway
cart00020  Citrate cycle (TCA cycle)
cart00480  Glutathione metabolism
cart01100  Metabolic pathways
cart01110  Biosynthesis of secondary metabolites
cart01120  Microbial metabolism in diverse environments
cart01130  Biosynthesis of antibiotics
cart01200  Carbon metabolism
cart01210  2-Oxocarboxylic acid metabolism
cart01230  Biosynthesis of amino acids
Module
cart_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cart_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cart00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA27867_2865
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PA27867_2865
Enzymes [BR:cart01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PA27867_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP ART-PolyVal
Motif
Other DBs
NCBI-ProteinID: ANP73803
UniProt: A0A1B1BN76
LinkDB All DBs
Position
1:complement(3186596..3187810)
Genome map
AA seq 404 aa AA seqDB search
MSKIKVAGTVVELDGDEMTRIIWQAIKDSLIHPYLDIDLEYYDLSIQKRDETDDQITIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWASPNGTIRNILGGTIFREPIIISNIPRL
VPGWNKPIIIGRHAFGDQYRATNFRFEGEGTLTMTFTPKDGGDPQQFEVFQAPGSGVAMG
MYNLDKSIIDFARASLNYGLERNYPVYLSTKNTILKAYDGRFKDIFQEIFDTEFKDRFEA
AGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLSTPDGS
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLSHRAKLDSNPALAEFAHTLED
VVVKTVESGKMTKDLALLVGPDQGYLTTEEFLAAISDNLQTRLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgaagatcaaggttgcaggtacagtcgtcgaactcgacggggacgagatgacccgc
atcatctggcaggccatcaaggactccctcattcacccgtacctcgacatcgacctcgag
tactacgacctgtcgatccagaagcgtgacgagaccgacgaccagatcacgatcgacgcg
gcccacgccatccagaagcacggtgtcggcgtcaagtgcgccaccatcacccccgacgag
gctcgtgtcgaggagttcggcctgaagaagatgtgggcctcgcccaacggcaccatccgc
aacatcctcggcggcaccatcttccgtgagccgatcatcatctccaacatcccgcgcctg
gtgccgggctggaacaagcccatcatcatcggccgccacgcgttcggcgaccagtaccgc
gccacgaacttccgcttcgagggcgaaggcaccctcaccatgaccttcaccccgaaggac
ggcggcgacccgcagcagttcgaggtcttccaggctcccggcagcggcgtggccatgggc
atgtacaacctcgacaagtcgatcatcgacttcgcccgcgcgtcgctcaactacggcctc
gagcgcaactacccggtctacctgtcgaccaagaacaccatcctcaaggcgtacgacggc
cggttcaaggacatcttccaggagatcttcgacaccgagttcaaggaccgcttcgaggcc
gccggcctcacctacgagcaccgtctgatcgacgacatggtcgcctctgccatgaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggcgacgtgcagtccgacaccgtg
gcacagggcttcggctcgctcggcctgatgaccagcgtgctctccacccccgacggcagc
gtcgtcgaggccgaggccgcgcacggcaccgtcacccggcactaccgccagcaccagcag
ggcaagcccacctcgactaacccgatcgcctcgatctacgcctggacccggggactctcg
caccgcgccaagctcgacagcaacccggcgctggccgagttcgcgcacactctcgaggat
gtggtcgtgaagaccgtcgagagcggcaagatgaccaaggacctcgccctgctcgtgggc
ccggaccagggctacctcaccaccgaggaattcctcgccgcgatcagcgacaacctgcag
acccgcctggcgtaa

DBGET integrated database retrieval system