KEGG   Cryobacterium arcticum: PA27867_3822Help
Entry
PA27867_3822      CDS       T04435                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cart  Cryobacterium arcticum
Pathway
cart00473  D-Alanine metabolism
cart00550  Peptidoglycan biosynthesis
cart01100  Metabolic pathways
cart01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cart00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PA27867_3822
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA27867_3822
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PA27867_3822
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cart01011]
    PA27867_3822
Enzymes [BR:cart01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PA27867_3822
Peptidoglycan biosynthesis and degradation proteins [BR:cart01011]
 Precursor biosynthesis
  Amino acid ligase
   PA27867_3822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_YheCD CPSase_L_D2 ATPgrasp_ST GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: ANP74737
UniProt: A0A1B1BQ86
LinkDB All DBs
Position
1:4166877..4167836
Genome map
AA seq 319 aa AA seqDB search
MSESEFLDVVVLAGGISHERDVSIRSGRRVADELTNLGHRVTLLDPQAGLLTELAERRPD
VIWPVLHGATGEDGALLSLLETTGIPHVGPRGTAAGLAWSKPTAKELVRRAGYSTPAWIA
LSRETFRDLGAASVLEHLVTALGTPLVVKPAQGGSAQGVTIVETAAGLPRAMVDAYTYAD
TALVETKIEGTELAVTVIDTGDGPQALPAVEIVPVSGVFSFEARYNAGETLFFTPARIAP
DIAATVAETAVAIHRLLGLAQLSRIDLMVDADGVAWFLEANVLPGLTETSLAPQSIEASG
ETLGAVYAALARAASVSLR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatccgagttccttgacgtagtggttctcgcgggcggcatctcgcacgaacgg
gacgtctccatccgcagcggccgacgcgtcgccgacgagctgaccaacctcggccaccgg
gtcaccctgctcgacccgcaagccggattgctcaccgaactcgccgagcgccggcctgac
gtcatctggccggtgctccacggtgccaccggagaagacggcgccctgctgtccctcctg
gaaaccacgggaatcccgcacgttggaccccggggaaccgcggcaggcctggcctggtcc
aagcccaccgccaaggaactcgtgcgccgggccgggtactccactccagcctggatcgcc
ctctcccgcgagaccttccgggacctcggtgcggccagcgtgctcgaacacctcgtcacc
gcgctcggcaccccgctggtggtcaagccggcccagggcggctcggcccagggtgtcacc
atcgtcgagaccgccgccgggcttccccgcgccatggtggatgcctacacctacgccgac
accgccctcgtggagaccaagatcgagggcaccgagctcgcggtgacagtcatcgacacc
ggcgacggcccccaggcccttccggccgtggaaatcgtgcccgtcagcggtgttttcagc
ttcgaagcccgctataacgccggcgaaacgctgttcttcacacccgcacgcatcgcgccg
gacatcgccgccactgtggcggagaccgccgtggcgatccaccgcctactcggtctggcc
cagctgtcccgaatcgacctcatggtggatgccgatggtgtcgcctggttcttggaagcg
aatgttctccccggcctcaccgagacgtcgctcgcaccccagtcgatcgaggcatccggc
gagactcttggcgccgtgtacgccgccctggcccgagccgcctcggtcagcttgcgctga

DBGET integrated database retrieval system