KEGG   Croceibacter atlanticus: CA2559_02415Help
Entry
CA2559_02415      CDS       T01256                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cat  Croceibacter atlanticus
Pathway
cat00240  Pyrimidine metabolism
cat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CA2559_02415
Enzymes [BR:cat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CA2559_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: EAP87572
UniProt: A3U5Q5
LinkDB All DBs
Position
complement(570676..571320)
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAKFARQKVEIFKPAIDVRYDEDM
VVSHDANEIRSTPVPAAANIRLLADGCDVVGIDEAQFFDDEIVAVCNDLANKGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSFRKSENDKLVMLGETEEYEP
LSRAAYFKARLREKLKTMPVKEAQELEAKKTPNN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaacacggtaaatcacaaagagcaatttggctggatagaagtcatttgc
ggatctatgttctccggtaaaaccgaagagcttatccgtaggctaaaacgcgcaaaattt
gctagacaaaaggttgaaatttttaaaccagctattgatgtacgctatgatgaagatatg
gtagtctctcatgatgctaacgaaatacgttccactccagttcctgctgccgcaaatata
agattgttggcagatggttgtgacgtggttggaatagatgaagctcaattttttgatgat
gagattgtggcggtctgtaacgatctagccaacaaaggtattcgagtaattgttgctggt
ctagatatggattttaaaggcaatccttttggacctatgcctaatcttatggctacagca
gagtatgttactaaagtacatgcggtttgtacacgtacaggaaatttagcgcaatatagt
tttagaaagtctgaaaatgacaaacttgttatgttgggcgaaactgaagaatatgaacct
ttaagtagagcagcatattttaaggcaaggttacgagagaaattaaaaaccatgccagta
aaagaagctcaagaattagaggctaaaaaaacaccaaataattaa

DBGET integrated database retrieval system