KEGG   Croceibacter atlanticus: CA2559_09468Help
Entry
CA2559_09468      CDS       T01256                                 

Definition
(GenBank) putative enoyl-[acyl-carrier-protein] reductase, NADH
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cat  Croceibacter atlanticus
Pathway
cat00061  Fatty acid biosynthesis
cat00780  Biotin metabolism
cat01100  Metabolic pathways
cat01130  Biosynthesis of antibiotics
cat01212  Fatty acid metabolism
Module
cat_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CA2559_09468
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CA2559_09468
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CA2559_09468
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cat01004]
    CA2559_09468
Enzymes [BR:cat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CA2559_09468
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CA2559_09468
Lipid biosynthesis proteins [BR:cat01004]
 Fatty acid synthase
  Component type
   CA2559_09468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Bcl-2
Motif
Other DBs
NCBI-ProteinID: EAP86252
UniProt: A3U8W6
LinkDB All DBs
Position
2070884..2071699
Genome map
AA seq 271 aa AA seqDB search
MSYNLLKGKRGIIFGALDENSIAWKTAERIHEEGGTFVLTNAPIAMRMGKIKDLAEKTGS
EIIPADATKVEDLEALVDGAMEKLGGKLDFVLHSIGMSVNVRKGNHYTDMNYDYTTKGWD
VSAVSFHKTMQSLYKKDAMNEWGSIVALTYMAAQRVFPDYNDMADNKAYLESIARSFGYF
FGKDKKVRVNTISQSPTPTTAGQGVKGFDGFIAYADKMSPLGNATALDCANYTVSLFSDL
TKRVTLQNLFHDGGFSNMGVSQAVMETFMDE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcatataacttattaaaaggaaaacgcgggattatatttggagctttagatgagaac
tctattgcttggaaaacagcagaaagaatacatgaagaaggaggaacttttgttttaaca
aacgcacctatagctatgcgtatgggaaaaattaaagatcttgcagaaaaaacaggttca
gaaatcattcctgcagacgctaccaaagtagaagatcttgaagcattagttgatggtgct
atggaaaaactaggagggaaactggactttgttcttcactcaataggaatgtctgttaat
gtaagaaaaggtaatcattatacagatatgaattatgactatacaaccaaaggttgggat
gtatctgcagtttcatttcataaaactatgcagtctctttataaaaaggatgcgatgaat
gaatggggtagtatagttgcattaacgtatatggcagcccaacgtgtatttccagattat
aatgatatggcagataataaagcctatttagagtctattgcacgtagctttggatatttc
tttggtaaggataaaaaagttagagtcaatacaatatcacaatctccaacacctacaact
gctggacaaggtgttaaaggtttcgatggctttatagcgtatgcagataaaatgtctcca
ttgggtaatgcaacagctttagattgtgctaactatactgtaagtttattttcagacctt
acaaaacgagtaacacttcaaaacttatttcatgatggtggcttttcaaatatgggagtt
agccaagcagtaatggaaacgtttatggatgagtaa

DBGET integrated database retrieval system