KEGG   Catenovulum sp. CCB-QB4: C2869_00860
Entry
C2869_00860       CDS       T05408                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C2869_00860
Enzymes [BR:cate01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     C2869_00860
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     C2869_00860
    1.1.1.-  
     C2869_00860
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_2 Pyr_redox AdoHcyase_NAD XdhC_C HI0933_like CHASE2
Other DBs
NCBI-ProteinID: AWB65079
UniProt: A0A2S0VLJ2
LinkDB
Position
240967..241989
AA seq 340 aa
MIAAQYVGNKGFEIVQGTDQAPEAGEVKLSVGYVGICGTDMHIYHGVMDQRVNPPQTIGH
EMSGTITAIGADVEGFEIGEKVVVRPLDWCGECPTCKAGLTHICQNLKFMGIDSAGAMQS
NWTVKARTLHKLPEGVSLKEGALVEPLSVACHDVSRSRLKAGEKAVVLGGGPIGQLVAAV
AKSVGADVLVSEPNESRRAFAEKLGVQSVNPLETDLAAFVDDWTGTKGADVVFEVSGVKP
AIDAMTQIAGRRGRIVMVAIHSQAPEIDLFQFFWKELELLGARVYEAADYDWAIELIASG
KVDPAPFISSVTPLEELGKAFASMDNNPQGMKALIECNAG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgatcgcagctcaatatgtaggaaacaaaggtttcgaaattgtacaaggtacagatcaa
gcgcctgaagcaggtgaagttaaattatctgttggctatgtgggtatttgtggtacggac
atgcacatttatcacggtgtaatggatcagcgtgttaatccaccgcaaacgatcggtcat
gaaatgtcaggtactatcaccgctattggtgctgacgttgaaggtttcgagattggtgaa
aaagtggttgttcgtccattagactggtgtggcgaatgtccaacatgtaaagcaggctta
acgcatatttgtcaaaaccttaagtttatgggtatcgattcggctggtgccatgcagtct
aactggactgttaaagcgcgtactttacacaagttacctgaaggcgtgagcttaaaagaa
ggggctttagtagagccattatctgttgcttgtcacgatgtgagtcgttcacgtttaaaa
gcgggcgaaaaagccgtcgtgttaggcggtggtcctatcggtcaattagtggctgcggta
gcaaaaagtgttggtgctgatgtattggtatcagagcctaacgagagccgtcgcgcattt
gcagaaaagttgggtgtacaatctgttaacccacttgaaactgatttagccgcttttgtt
gatgactggacaggtactaaaggtgctgacgtcgtatttgaagtatcaggtgttaaacct
gctattgatgcaatgacacaaatcgctggtcgtcgtggccgtatcgttatggttgctatt
cactcgcaagcacctgaaattgatttattccaatttttctggaaagaactagagctatta
ggcgcacgtgtatacgaagcggctgattatgactgggctatcgaattgattgcttcaggt
aaagttgacccggctccatttatcagttctgtaacgccattagaagaattaggcaaagcg
tttgccagcatggataacaatccacagggcatgaaagcccttattgaatgtaacgcgggt
taa

DBGET integrated database retrieval system