KEGG   Catenovulum sp. CCB-QB4: C2869_00860Help
Entry
C2869_00860       CDS       T05408                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
cate  Catenovulum sp. CCB-QB4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_2 Pyr_redox AdoHcyase_NAD XdhC_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: AWB65079
UniProt: A0A2S0VLJ2
LinkDB All DBs
Position
240967..241989
Genome map
AA seq 340 aa AA seqDB search
MIAAQYVGNKGFEIVQGTDQAPEAGEVKLSVGYVGICGTDMHIYHGVMDQRVNPPQTIGH
EMSGTITAIGADVEGFEIGEKVVVRPLDWCGECPTCKAGLTHICQNLKFMGIDSAGAMQS
NWTVKARTLHKLPEGVSLKEGALVEPLSVACHDVSRSRLKAGEKAVVLGGGPIGQLVAAV
AKSVGADVLVSEPNESRRAFAEKLGVQSVNPLETDLAAFVDDWTGTKGADVVFEVSGVKP
AIDAMTQIAGRRGRIVMVAIHSQAPEIDLFQFFWKELELLGARVYEAADYDWAIELIASG
KVDPAPFISSVTPLEELGKAFASMDNNPQGMKALIECNAG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcagctcaatatgtaggaaacaaaggtttcgaaattgtacaaggtacagatcaa
gcgcctgaagcaggtgaagttaaattatctgttggctatgtgggtatttgtggtacggac
atgcacatttatcacggtgtaatggatcagcgtgttaatccaccgcaaacgatcggtcat
gaaatgtcaggtactatcaccgctattggtgctgacgttgaaggtttcgagattggtgaa
aaagtggttgttcgtccattagactggtgtggcgaatgtccaacatgtaaagcaggctta
acgcatatttgtcaaaaccttaagtttatgggtatcgattcggctggtgccatgcagtct
aactggactgttaaagcgcgtactttacacaagttacctgaaggcgtgagcttaaaagaa
ggggctttagtagagccattatctgttgcttgtcacgatgtgagtcgttcacgtttaaaa
gcgggcgaaaaagccgtcgtgttaggcggtggtcctatcggtcaattagtggctgcggta
gcaaaaagtgttggtgctgatgtattggtatcagagcctaacgagagccgtcgcgcattt
gcagaaaagttgggtgtacaatctgttaacccacttgaaactgatttagccgcttttgtt
gatgactggacaggtactaaaggtgctgacgtcgtatttgaagtatcaggtgttaaacct
gctattgatgcaatgacacaaatcgctggtcgtcgtggccgtatcgttatggttgctatt
cactcgcaagcacctgaaattgatttattccaatttttctggaaagaactagagctatta
ggcgcacgtgtatacgaagcggctgattatgactgggctatcgaattgattgcttcaggt
aaagttgacccggctccatttatcagttctgtaacgccattagaagaattaggcaaagcg
tttgccagcatggataacaatccacagggcatgaaagcccttattgaatgtaacgcgggt
taa

DBGET integrated database retrieval system