KEGG   Catenovulum sp. CCB-QB4: C2869_06345Help
Entry
C2869_06345       CDS       T05408                                 

Definition
(GenBank) bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00061  Fatty acid biosynthesis
cate01100  Metabolic pathways
cate01212  Fatty acid metabolism
Module
cate_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C2869_06345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cate01004]
    C2869_06345
Enzymes [BR:cate01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C2869_06345
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     C2869_06345
Lipid biosynthesis proteins [BR:cate01004]
 Fatty acid synthase
  Component type
   C2869_06345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AWB66083
UniProt: A0A2S0VPG5
LinkDB All DBs
Position
1819362..1819847
Genome map
AA seq 161 aa AA seqDB search
MQFSNKQILAMARGGFFGEGNAQLPSEQMLMIDQINNICSEGGVYDKGQLAASFNIKPEH
WFFDCHFAGDPVMPGCLGLDALWQLLGVYLGWLGLPGRGRALGVNKVKFSGQIYPDAKKI
EYRLDIKRVIKRPLPVGIADGKVLLNNEVIYQADSLKVGLI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcagttttcaaacaaacaaatattggctatggcgcgaggtggcttttttggtgagggc
aacgctcaactgccttcagaacaaatgctaatgatagatcagattaacaatatctgttcc
gagggtggggtttatgataaaggtcaactggctgcaagttttaacattaaaccagagcat
tggttttttgattgtcactttgctggcgatcctgttatgccgggctgtttggggctagat
gctttgtggcaactattaggcgtatatctcggttggctaggtttacctggtagaggacgt
gctttaggcgtaaataaagttaagtttagcgggcaaatttatccagacgccaaaaaaatt
gaatatcggcttgatataaaaagagtgatcaaacgacctttgccagttggcattgctgat
ggcaaagtattgttaaacaatgaagtgatttatcaagctgattcacttaaagttggcctg
atttaa

DBGET integrated database retrieval system