KEGG   Catenovulum sp. CCB-QB4: C2869_10260Help
Entry
C2869_10260       CDS       T05408                                 

Definition
(GenBank) hypothetical protein
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00270  Cysteine and methionine metabolism
cate00330  Arginine and proline metabolism
cate00410  beta-Alanine metabolism
cate00480  Glutathione metabolism
cate01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    C2869_10260
   00330 Arginine and proline metabolism
    C2869_10260
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2869_10260
   00480 Glutathione metabolism
    C2869_10260
Enzymes [BR:cate01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     C2869_10260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Methyltransf_25 Methyltransf_23 MTS Methyltransf_17 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AWB66786
UniProt: A0A2S0VRE0
LinkDB All DBs
Position
2889851..2890519
Genome map
AA seq 222 aa AA seqDB search
MLVDLKNSLADGHLLALQVENDIRWQVMENNTYRWLTLNHTVQTVMDKQDTTSLLFPHQQ
PLVSHLPALPPNPKVLEIGLGGGSQFRFLKQLYPAAKYKVVEPSQIVIELFQQYFNPSNL
ALHCALEMGQNYLSHTQQTYDLILSDIYSHQSSSMNLLTQDYCQLLIEKLAIKGVVFINL
MPETKFEIALLMANFSAKCMKLLYSDKISGYRNHVMLYQKIS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgtcgacctgaaaaatagtttagcagacggtcatttattggcattacaagttgaa
aatgacattcgctggcaggtaatggaaaataatacttatcgctggttaacgctaaaccat
acagtacaaacagtgatggataagcaggatacgacttctttattgtttccgcatcagcag
cctttagtcagtcatttacctgctttaccgcctaatccaaaggtgttagagataggttta
ggtggtggcagccaatttcgctttttaaaacaattatacccagcagcaaagtataaggtg
gtagaacctagccagatcgtgatagagctgtttcagcaatattttaatcccagtaactta
gctttacattgtgcgttagaaatgggacagaactatttgagccacactcagcaaacgtat
gatcttattttgagcgatatctacagccatcaatcttccagtatgaacctattaactcag
gattattgccaacttttaatagaaaaattggctataaaaggggttgtttttataaattta
atgcctgaaacaaaatttgaaatagccttactaatggctaatttttcagcaaaatgcatg
aaattgttatattctgacaaaataagtggttatagaaatcacgtaatgttatatcaaaag
atcagttag

DBGET integrated database retrieval system