KEGG   Catenovulum sp. CCB-QB4: C2869_10650Help
Entry
C2869_10650       CDS       T05408                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00480  Glutathione metabolism
cate01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2869_10650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cate02000]
    C2869_10650
Enzymes [BR:cate01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C2869_10650
Transporters [BR:cate02000]
 Other transporters
  Pores ion channels [TC:1]
   C2869_10650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 GST_C_3 GST_N_4 Tom37 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AWB66863
UniProt: A0A2S0VRP2
LinkDB All DBs
Position
complement(2978759..2979421)
Genome map
AA seq 220 aa AA seqDB search
MLPIELVSFKLCPFVQRSVITLKQKNIEFAITYIDLADKPDWFLAMSPLGKVPVLKYGDE
VLFESAVINEFLDEITPPTLMPYEPINKAKDRAWIEYTSQCLMNQYTWLNATNAAEEDKQ
QTALHSKLTRLEAQVPEQGFFNGDDFSLVDSSLAPFFHRFAILQKQKGINILANYPKLQA
LSEQYMALDSVTQSVVADFDSLFIDYFAKQDSYIVNKPNA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgttacccattgaacttgttagttttaaattgtgcccttttgttcaacgctcagttatt
acgcttaaacagaagaacattgaatttgccattacttatatcgatctggccgataaaccg
gactggtttttagccatgtcaccacttggcaaagtacctgtattgaaatatggcgacgag
gtattgtttgaatcagccgtgattaacgaatttcttgacgagatcacaccgccgacatta
atgccttatgaaccaatcaacaaagccaaagatcgagcttggatagaatacaccagccaa
tgtttaatgaatcagtatacgtggcttaacgccacaaacgcagctgaggaagataaacag
caaaccgcactgcatagcaaactgactcgtttagaagcgcaagtcccagagcagggattt
tttaatggtgacgacttcagcctagtagactcttcccttgcaccttttttccatcgtttc
gctattttgcaaaagcaaaaaggtattaatattttagcgaattatcctaaattgcaggct
ttgtctgagcagtacatggcattggattcggttacccaatcggtagtggcagattttgac
agcttatttatcgattattttgccaagcaagatagttatatcgttaataagccgaacgcc
taa

DBGET integrated database retrieval system