KEGG   Catenovulum sp. CCB-QB4: C2869_11245Help
Entry
C2869_11245       CDS       T05408                                 

Gene name
panP
Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00650  Butanoate metabolism
cate01100  Metabolic pathways
cate01110  Biosynthesis of secondary metabolites
cate01120  Microbial metabolism in diverse environments
cate02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C2869_11245 (panP)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2869_11245 (panP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2869_11245 (panP)
   00430 Taurine and hypotaurine metabolism
    C2869_11245 (panP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C2869_11245 (panP)
Enzymes [BR:cate01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C2869_11245 (panP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DUF5446
Motif
Other DBs
NCBI-ProteinID: AWB68994
UniProt: A0A2S0VXQ3
LinkDB All DBs
Position
3149468..3151117
Genome map
AA seq 549 aa AA seqDB search
MRAETNKQATANEESLLRIFTVPEAPDSTLGRIEQEISQNLNGFLSEHLVAKEHKLSEIE
KDFSDAQLPEEPQFVSDHTSFLLDKLVAQSVHTSSPSFIGHMTSALPYFMLPMSKIMIAL
NQNLVKIETSKAFTPLERQVLGMMHNLVYGGASSFYQEYMHSEQFSLGAFCSGGTIANVT
ALWVARNNLFKPSGNFKGVAQSGLYKALLHYGYKGAAVLVSERGHYSLAKSADLLGIGRE
DVIAIPTDANNRVDIDKLRSTAKQLRDNGIAILAMVGVAGTTETGNIDPLAEMAAVASEV
GCHFHVDAAWGGSTLFSHKYASLLAGIELADSVTIDAHKQMYVPMGAGIVLFKDPSLAGH
IEHHAEYVLRKGSKDLGSHTLEGSRPGMAMLVFASMNILGRKGYQLLIDRSIEQARYFAE
LINQQDDFELVSHPELCLLTYRYVPAPLKAILRSGNQVLISQVNEYLDDLTKYVQKRQRE
AGKSFVSRTRINPSIYQGQSITVFRVVLANPLTTQQILQDVLQEQRELAQTSQIALPMLM
KMLAQWQAA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgagagcagaaaccaacaagcaagcaacagcgaatgaagagtccttgctgcgtattttt
accgtgccagaggcgcctgattctacattggggcgtatagagcaggaaatttcgcaaaat
ttaaatggctttctttcagagcatttagtggctaaagagcacaaactgagtgaaattgaa
aaagatttctctgatgcacaattacctgaagaaccgcagtttgtttctgatcacaccagt
tttttgttagataaattggtagctcaatccgttcacacctcttctcctagctttattgga
catatgacatcggcgttgccctattttatgttaccaatgtcaaaaattatgattgctctc
aatcaaaacctagtcaaaattgaaacctcaaaggcgtttacgccgttagagcgtcaagta
ctgggtatgatgcacaatttagtttatggcggtgcatcgagtttttatcaagaatatatg
cactctgaacagttttcactgggcgcattctgctcgggtggaacaatagcgaatgtaact
gcgttatgggttgctcgtaataacttgtttaagccaagtggcaattttaaaggtgttgcc
caaagtggtttatacaaagccttattgcattatggctataagggcgctgcagttttagtg
tcggagcgcggtcattattcattggctaagtcagccgatttactcggcattggccgtgaa
gatgtcattgcaattccaaccgatgctaataaccgtgtcgatattgataagttacgcagc
acagcaaaacagttgcgtgataatggtattgccattttagctatggttggggttgccggt
accacagaaaccggtaatattgatccactggctgagatggctgcagtcgcgagtgaagtt
gggtgtcattttcatgtcgacgcggcttggggtggttccaccctgttttcgcataaatac
gcttccttactggctggcattgagttggctgattctgtgactattgatgcccataaacaa
atgtacgtgcctatgggtgcgggcattgttttgtttaaagatccttccttggcaggacat
atcgagcaccacgcagaatatgtactaagaaaaggttcaaaagatttaggtagccatacg
ttagaaggttcgcgtcctggtatggccatgttggtcttcgccagtatgaatattttgggc
cgaaaaggttatcaattgttaatcgaccgaagtattgagcaggcacgttactttgcggaa
ttgataaaccaacaagacgattttgagttggtctctcaccctgagttatgtttactgact
tatcgttatgttcctgcgccacttaaggcgattttacgcagtggtaaccaagtacttatt
agtcaggttaatgagtatcttgatgacttaactaagtatgtgcaaaagcgccaacgtgaa
gccggaaaatcatttgtttctcgaactcgtattaatccgagtatttatcaagggcaatcg
attacggtttttcgagtcgtgttggctaatccactaacaacgcaacagattttacaagat
gttttgcaagagcagcgagaattagcgcaaaccagtcaaattgccctgccaatgttaatg
aaaatgttagcgcaatggcaagccgcttaa

DBGET integrated database retrieval system