KEGG   Catenovulum sp. CCB-QB4: C2869_11245Help
Entry
C2869_11245       CDS       T05408                                 

Gene name
panP
Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00250  Alanine, aspartate and glutamate metabolism
cate00410  beta-Alanine metabolism
cate00430  Taurine and hypotaurine metabolism
cate00650  Butanoate metabolism
cate01100  Metabolic pathways
cate01110  Biosynthesis of secondary metabolites
cate01120  Microbial metabolism in diverse environments
cate02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C2869_11245 (panP)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2869_11245 (panP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2869_11245 (panP)
   00430 Taurine and hypotaurine metabolism
    C2869_11245 (panP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C2869_11245 (panP)
Enzymes [BR:cate01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C2869_11245 (panP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DUF5446
Motif
Other DBs
NCBI-ProteinID: AWB68994
LinkDB All DBs
Position
3149468..3151117
Genome map
AA seq 549 aa AA seqDB search
MRAETNKQATANEESLLRIFTVPEAPDSTLGRIEQEISQNLNGFLSEHLVAKEHKLSEIE
KDFSDAQLPEEPQFVSDHTSFLLDKLVAQSVHTSSPSFIGHMTSALPYFMLPMSKIMIAL
NQNLVKIETSKAFTPLERQVLGMMHNLVYGGASSFYQEYMHSEQFSLGAFCSGGTIANVT
ALWVARNNLFKPSGNFKGVAQSGLYKALLHYGYKGAAVLVSERGHYSLAKSADLLGIGRE
DVIAIPTDANNRVDIDKLRSTAKQLRDNGIAILAMVGVAGTTETGNIDPLAEMAAVASEV
GCHFHVDAAWGGSTLFSHKYASLLAGIELADSVTIDAHKQMYVPMGAGIVLFKDPSLAGH
IEHHAEYVLRKGSKDLGSHTLEGSRPGMAMLVFASMNILGRKGYQLLIDRSIEQARYFAE
LINQQDDFELVSHPELCLLTYRYVPAPLKAILRSGNQVLISQVNEYLDDLTKYVQKRQRE
AGKSFVSRTRINPSIYQGQSITVFRVVLANPLTTQQILQDVLQEQRELAQTSQIALPMLM
KMLAQWQAA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgagagcagaaaccaacaagcaagcaacagcgaatgaagagtccttgctgcgtattttt
accgtgccagaggcgcctgattctacattggggcgtatagagcaggaaatttcgcaaaat
ttaaatggctttctttcagagcatttagtggctaaagagcacaaactgagtgaaattgaa
aaagatttctctgatgcacaattacctgaagaaccgcagtttgtttctgatcacaccagt
tttttgttagataaattggtagctcaatccgttcacacctcttctcctagctttattgga
catatgacatcggcgttgccctattttatgttaccaatgtcaaaaattatgattgctctc
aatcaaaacctagtcaaaattgaaacctcaaaggcgtttacgccgttagagcgtcaagta
ctgggtatgatgcacaatttagtttatggcggtgcatcgagtttttatcaagaatatatg
cactctgaacagttttcactgggcgcattctgctcgggtggaacaatagcgaatgtaact
gcgttatgggttgctcgtaataacttgtttaagccaagtggcaattttaaaggtgttgcc
caaagtggtttatacaaagccttattgcattatggctataagggcgctgcagttttagtg
tcggagcgcggtcattattcattggctaagtcagccgatttactcggcattggccgtgaa
gatgtcattgcaattccaaccgatgctaataaccgtgtcgatattgataagttacgcagc
acagcaaaacagttgcgtgataatggtattgccattttagctatggttggggttgccggt
accacagaaaccggtaatattgatccactggctgagatggctgcagtcgcgagtgaagtt
gggtgtcattttcatgtcgacgcggcttggggtggttccaccctgttttcgcataaatac
gcttccttactggctggcattgagttggctgattctgtgactattgatgcccataaacaa
atgtacgtgcctatgggtgcgggcattgttttgtttaaagatccttccttggcaggacat
atcgagcaccacgcagaatatgtactaagaaaaggttcaaaagatttaggtagccatacg
ttagaaggttcgcgtcctggtatggccatgttggtcttcgccagtatgaatattttgggc
cgaaaaggttatcaattgttaatcgaccgaagtattgagcaggcacgttactttgcggaa
ttgataaaccaacaagacgattttgagttggtctctcaccctgagttatgtttactgact
tatcgttatgttcctgcgccacttaaggcgattttacgcagtggtaaccaagtacttatt
agtcaggttaatgagtatcttgatgacttaactaagtatgtgcaaaagcgccaacgtgaa
gccggaaaatcatttgtttctcgaactcgtattaatccgagtatttatcaagggcaatcg
attacggtttttcgagtcgtgttggctaatccactaacaacgcaacagattttacaagat
gttttgcaagagcagcgagaattagcgcaaaccagtcaaattgccctgccaatgttaatg
aaaatgttagcgcaatggcaagccgcttaa

DBGET integrated database retrieval system