KEGG   Catenovulum sp. CCB-QB4: C2869_14515Help
Entry
C2869_14515       CDS       T05408                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cate  Catenovulum sp. CCB-QB4
Brite
Enzymes [BR:cate01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C2869_14515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AWB67579
UniProt: A0A2S0VTP4
LinkDB All DBs
Position
complement(4002890..4003474)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYELDALEPHFSKETLEFHYGKHHQTYVTKLNGLVEGTDNAEKSLEEIIKSS
EGGLFNNAAQIWNHTFYWNCLSPNGGGEPTGAVADAINAAFGSFEEFQKQFDDKAVNNFG
SSWTWLVKNADGSLALVNTSNAGTPITEEGVTPLLTVDLWEHAYYIDFRNARPAYLTAFW
KLVNWEFVAANLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgaattaccagctttaccctacgaattagatgcattagagccacacttttct
aaagaaactttagaatttcactatggtaagcatcatcaaacttacgtaactaagctaaac
ggtttagttgaaggtactgataacgcagaaaaaagtttagaagaaatcattaagtcgtct
gaaggtggtttattcaacaacgctgctcaaatttggaaccacactttttactggaactgt
ttatcaccaaatggtggtggcgagccaacaggtgctgtagctgatgcaatcaacgctgca
tttggttctttcgaagagttccaaaaacaatttgatgacaaagcagttaataactttggt
tcaagctggacttggttagttaaaaatgctgatggttctttagcattggttaatacatca
aatgctggaacgccaatcacagaagaaggtgtaactccgctattaactgttgatttatgg
gaacatgcgtattacatcgatttccgtaatgctcgcccagcttatttaacagcgttctgg
aaattagttaattgggaattcgtagctgctaacctagctaagtaa

DBGET integrated database retrieval system