KEGG   Catenovulum sp. CCB-QB4: C2869_17715Help
Entry
C2869_17715       CDS       T05408                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00061  Fatty acid biosynthesis
cate00780  Biotin metabolism
cate01100  Metabolic pathways
cate01212  Fatty acid metabolism
Module
cate_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C2869_17715 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C2869_17715 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cate01004]
    C2869_17715 (fabZ)
Enzymes [BR:cate01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C2869_17715 (fabZ)
Lipid biosynthesis proteins [BR:cate01004]
 Fatty acid synthase
  Component type
   C2869_17715 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AWB68141
UniProt: A0A2S0VV96
LinkDB All DBs
Position
complement(4723347..4723808)
Genome map
AA seq 153 aa AA seqDB search
MSSELNTVDIQEIFELLPHRYPFLLIDRVVDFEVEKSVHGYKNITINEPIFNGHFPGKPI
FPGVLIIEALAQATGILGFKTMQARGGLTGNELYLLASVDNVRFKRPVVPGDQLHLHAEL
IKERRGMWKFSCEAKVDGELACSAEIMCAAREM
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
ttgagtagcgaattaaatacggttgatatccaagaaatatttgaactattgccgcatcgt
tatccgtttttattaattgaccgtgttgttgattttgaagttgaaaagtcagtgcatggt
tacaaaaatattactatcaacgagcctatttttaatggtcactttccaggaaagcctatt
ttcccaggtgtgttgattatagaagccttagcgcaagctactggtattttaggttttaaa
accatgcaagcgcgtggcggcctaacaggcaatgaactatatttattagcttcagttgat
aacgttagatttaagcgcccagttgttcctggagaccaactgcatttgcacgctgaacta
attaaagaacgacgtggcatgtggaaattttcgtgtgaagccaaagttgacggagagtta
gcttgctcagcggaaattatgtgtgccgctagagagatgtaa

DBGET integrated database retrieval system