KEGG   Catenovulum sp. CCB-QB4: C2869_18395Help
Entry
C2869_18395       CDS       T05408                                 

Definition
(GenBank) hypothetical protein
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00030  Pentose phosphate pathway
cate01100  Metabolic pathways
cate01110  Biosynthesis of secondary metabolites
cate01120  Microbial metabolism in diverse environments
cate01130  Biosynthesis of antibiotics
cate01200  Carbon metabolism
Module
cate_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cate_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
cate_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C2869_18395
Enzymes [BR:cate01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     C2869_18395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SGL GspH
Motif
Other DBs
NCBI-ProteinID: AWB68261
UniProt: A0A2S0VVL8
LinkDB All DBs
Position
4892271..4893389
Genome map
AA seq 372 aa AA seqDB search
MQKLILSLLSAWLLLIQLPSASAQQNEFYVASGDNGIYRLTINGQKNRLAKPQKVADVNH
VGFLTQHPTKAILYAVANHNEAVVMGFTKHKNGQLSMLNSQAINDGQTAGTHLAVHPSGK
WLTTVQYRTGSVSVFPLAADGQIKPRSQLIHHQAVKQQGSKKTKPARPHWVGYSPDGRFV
FIPDLGQDQIVIYQVTEQGQLQAHGFSQVKKGSGPRHMKFSKDGNFVYLLNELAMTVSVF
AYDAQQGTLTAIQDDQATIDEADWRTASRHSASEIRVHANGQLIYTANRGHDSISIFKVS
DNGQIKRIANESVRGAEPRNFALDNTGQWLVSAGLASNSLSLFTVDPVSGLLQFQRGQVQ
AVPKPLCVLFWR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaactcatcttatctttgctttcagcttggctattgctaatccaattgccaagt
gccagtgcgcaacaaaacgaattttatgttgcatcaggcgacaatggcatatatcgactt
accattaatggccaaaaaaatcgcctagcaaaaccacaaaaggtggcagatgttaatcat
gtcggctttttaacccagcatcccactaaagctattttatatgcagtggccaatcacaac
gaagccgtggttatgggttttaccaagcataaaaatggtcaactcagcatgctaaacagc
caagccattaatgacgggcaaaccgcaggcacgcatttggccgtacaccctagcggaaag
tggctgaccacagtgcaatatcgtactggctcagttagcgtgtttccattagcagcagat
ggtcaaatcaagccgcgcagccaattaattcatcaccaagccgttaagcaacaaggtagt
aaaaaaaccaaaccggctcggccacattgggtaggttattcaccagatggcagatttgtt
tttattcccgaccttggccaagaccaaattgttatttatcaagtaacagaacaaggacaa
ttacaagcgcatggcttttctcaagtcaaaaagggcagcggcccgcgccacatgaagttt
tctaaggatggcaattttgtttacttgctaaatgagctagccatgacagtatctgttttt
gcctatgacgcgcaacaaggtaccttgaccgctatccaggatgaccaagcaacaatagat
gaagcagattggcgtaccgccagccgtcactccgcatccgagatccgcgtacatgctaat
ggccaattaatctacaccgccaatcgcggccatgattcaatcagtatttttaaagtcagc
gacaatggtcagattaagcgtattgcaaacgaatcagtcagaggagctgaaccacgtaat
tttgcattagataacacgggacaatggttggtcagtgccggtttggcgtcgaacagcttg
tcactatttacagttgatcccgtgtctggcttattgcaatttcaacgcggccaagtacaa
gctgtacctaaaccgctttgtgttttattttggcgctag

DBGET integrated database retrieval system