KEGG   Catenovulum sp. CCB-QB4: C2869_22225Help
Entry
C2869_22225       CDS       T05408                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cate  Catenovulum sp. CCB-QB4
Brite
KEGG Orthology (KO) [BR:cate00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2869_22225 (ahpF)
Enzymes [BR:cate01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C2869_22225 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like DAO Thi4 NAD_binding_8 Lycopene_cycl FAD_binding_2 AlaDh_PNT_C NAD_binding_7 Thioredoxin_4 K_oxygenase ABC_transp_aux FAD_binding_3 Glutaredoxin Thioredoxin_9 DUF2597 SMK-1 DSBA 3HCDH_N VbhA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AWB69221
UniProt: A0A2S0VYD6
LinkDB All DBs
Position
unnamed1:complement(155113..156684)
Genome map
AA seq 523 aa AA seqDB search
MLNNDILQALKTYTANMTKAVTLVVQTGEHAKKQELTEFLSQICSVSDKLSWQERNINLR
SPISFALEVEQDNTQQNTGIVFSGIPAGHEFNSLVLAILQSSGTAIKLDNTLVNLVANIN
EPLHFEVFVSLSCHNCPDVVQSLNQFALLNPNISSEMIDGGLFQEVVEQRNIQGVPSVYV
NGELFANGKIDTAQLVDKLIARYPDFVGSFNVEQLPEQDITVIGGGPAGVAAAIYAARKG
LKVTMVADRIGGQVKDTVGIENLISVPKTTGTQLTSNMLAHMNDYDITKKEHVRITDIAA
PPTGAKTLTLSSGEVINSKAIIVATGAKWRELGVPGEKENIGSGVAYCPHCDGPFFKGKD
VAVIGGGNSGVEAALDLAGMVQHVTLFEFLPELKADKVLVEKAQANDKISIVTNAATKQI
IADNGKVVAIEYIDRMTEQVLRKNLSGVFVQIGLVPNSEFLQGVVERTPYGEVVIDEKCQ
TSQVGIFAAGDVTTVPYKQIVIAMGEGAKASLSAFDYLLRSAD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaatgatattttacaagcacttaaaacatatacagcaaacatgacaaaagct
gtgactctggttgtgcaaacgggagagcacgccaaaaaacaagaattaacagagttttta
agccagatttgctctgtatcagacaagttgagttggcaagagcgaaatattaatttacgc
agcccaattagttttgcccttgaagtagagcaggacaacacgcaacagaataccggaatt
gtgttttctgggatccctgcgggtcatgagtttaactctttggtgttggcaatactccaa
tcttcgggaaccgcgattaagcttgataataccttggtcaatttagtcgcgaatataaac
gaaccattgcactttgaggtgtttgtgtcgttaagttgccacaattgtcccgatgttgtg
cagtcgcttaatcaatttgcgttacttaaccccaatatttccagtgaaatgattgacggc
ggcttatttcaagaggtcgtcgaacaacgcaatatacaaggtgtaccgagtgtttatgtt
aatggtgaattatttgctaatggtaaaattgataccgcgcaactggttgataaattgata
gcccgttatcccgattttgtagggtcgttcaacgttgaacaattgcccgagcaagatatt
accgtaataggtggcggccccgctggtgttgccgctgccatttatgccgcacgcaaaggg
ttaaaagtgactatggttgctgatcgtattggtgggcaggtaaaagatacagtcggcatt
gaaaacttaatatcagtaccgaaaaccacgggtacgcagttaacctcaaatatgctggca
cacatgaatgattatgacattaccaaaaaagaacatgtcaggatcacagacattgcggca
ccaccaactggcgctaaaacgttaactttgtcttctggtgaagtaattaatagtaaagcc
attattgtggccactggcgctaagtggcgtgagctaggcgtaccaggcgaaaaagaaaac
attggctctggggtggcttattgtccgcattgcgatggccctttctttaaaggtaaagat
gtggccgtgatcggtggcggtaactcaggcgttgaagccgcattggatttagccggtatg
gtgcagcacgtcaccttgtttgaatttttacccgagcttaaagcggataaagttttagta
gaaaaggcacaagctaatgacaagattagtatagttaccaatgccgccaccaaacagatt
attgctgacaatggtaaagtggtggctattgagtacattgatcgcatgactgaacaagtg
ttgcggaaaaacttatctggcgtatttgtgcaaatcggtttagtgcctaacagtgaattt
ttgcaaggggttgtcgagcgtacaccatatggcgaagtggttattgatgaaaaatgccaa
acttctcaggtgggtatatttgctgctggagacgtgacaaccgtaccttacaaacaaata
gtcattgccatgggagaaggagccaaagcctcgttatctgcttttgattatttgcttcgc
agtgcggattaa

DBGET integrated database retrieval system