KEGG   Chloroflexus aurantiacus: Caur_0055Help
Entry
Caur_0055         CDS       T00639                                 

Definition
(RefSeq) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cau  Chloroflexus aurantiacus
Brite
KEGG Orthology (KO) [BR:cau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cau01001]
    Caur_0055
Enzymes [BR:cau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Caur_0055
Protein kinases [BR:cau01001]
 Serine/threonine kinases: Other
  Bacterial family
   Caur_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Pkinase_fungal SBBP RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5828192
NCBI-ProteinID: YP_001633698
UniProt: A9WAT1
LinkDB All DBs
Position
complement(64394..66088)
Genome map
AA seq 564 aa AA seqDB search
MTGGSGRRIGRYELIEELGRGGMARVYRARDTQLQRIVALKVLAAQLSMDAEFIKRFERE
ARTAANLRHPHIVTVYDIGEDQGLHYIAMEYIDGRPLHAILEQYGSLGLKYAIAILEPIA
LALDYAHQAGAVHRDVKPHNILIDRNGRVVLTDFGIAQTPEADEQRLTRTGVFMGTPEYI
SPEQAEARRVDGRSDLYSLAVVAYEIIAGRVPFSGATPQLIVAHAQLPPPPITSFAPDLP
TDLDLVLTRALAKRPERRFQTGAAFIAALRDIAERNGIVPATTAELVALLNPSLQVESTI
PGLVQSSATPKPVAPPLLSSTPTASRQPKQPDGLAVNQDQRATPLPPAPVIPRRHLPEPA
VAEPKPRNNRSDQWPFFIIGGLLFIIVGALVVLIMRNFDDSDAPTPTPIVPAGPSPTLAV
PLPTATATFTAVPTLTPTLTPSVEPTPTPVLPTPVPPTSPPPPPPPPPPSPTPTVTATPT
ETVTPTVSLTPTEPATPTETATPTETATPTETATPTETTTPTVSPTPTETATPTVSPTPT
ETTTPTVSPTPTETATPTVSPTPT
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgactggtggaagcggacggcgaatcggtcgctacgaattgatcgaagagcttggccgc
ggcggcatggcacgagtgtatcgcgcccgtgatacacaacttcaacggatcgttgccctg
aaagtgctggccgcgcaactaagcatggacgcagagttcatcaagcgctttgagcgcgag
gcccgcacggcagccaatctgcgccatcctcacatcgtaacggtttacgacattggtgaa
gatcagggactgcactacattgcaatggagtatattgatggccggccgttgcacgcgatc
ctcgagcaatacggttcactcggcctgaaatacgctattgctattcttgaaccaatcgcg
cttgccctcgattatgctcatcaggccggtgccgttcatcgtgatgtcaaaccgcacaat
attttgatcgaccgtaacgggcgggtggtattaaccgatttcggcattgcgcaaacgcct
gaggctgatgaacaacgattgacccgcaccggtgtgtttatgggcacaccagagtatatc
tcacctgaacaggctgaagcccggcgggttgatggtcgtagtgatctctactcattagcg
gtagttgcgtatgagatcattgccggtcgtgtaccgtttagtggtgccacgcctcaattg
atcgttgcccatgctcagttaccaccgccacctatcacctcatttgcccctgatttaccg
actgaccttgatttggtactgacgcgggcgttggccaagcgtccagaacgacggtttcag
accggtgcagcattcattgctgccctgcgtgatattgcggaacggaacggaatcgtaccg
gcaacaactgccgagctggtggcgctgttgaatccctcgttgcaagtagagtcaactatt
ccgggactggtacaatcttcagcgactcccaaaccggtcgcgccaccacttctatcctca
acccccacagccagcagacaacccaaacaaccggacggcctggcggttaatcaagaccag
cgggcaacaccactgccgccagcaccagtgataccacgacgtcatctgccagaacctgcc
gtagcagagccaaaacctcgtaataatcgctcggatcaatggccatttttcattatcggc
ggtttactttttattattgttggcgcacttgtggtgctgattatgcgcaactttgatgac
agtgatgctccgacgccaactccaatcgttccggctgggccatcaccgacgctcgctgtg
ccactaccgacagctactgcaacctttactgccgtaccaacgctaacgccgaccctgaca
ccatcggtcgagccaacgccgacaccggtactaccaacacccgtaccgccaacttcacca
ccgccaccaccaccgccgcccccgccgtcaccgactccaaccgtcacagcgacaccgacg
gagacggtgacaccaaccgtctcgctaacaccgacggaaccggcgacaccaaccgagacg
gcgacgccaaccgagacggcaacaccgacggagacggcgacgccaaccgagacaacgaca
ccgaccgtctcgccgacaccaacggaaacggcaacaccgaccgtctcgccgacgccaacc
gagacaacgacaccgaccgtctcgccgacaccaacggaaacggcaacaccgaccgtctcg
ccgacgccaacctag

DBGET integrated database retrieval system