KEGG   Chloroflexus aurantiacus: Caur_0167Help
Entry
Caur_0167         CDS       T00639                                 

Definition
(RefSeq) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01130  Biosynthesis of antibiotics
cau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caur_0167
Enzymes [BR:cau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Caur_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 5824741
NCBI-ProteinID: YP_001633810
UniProt: A9WC28
LinkDB All DBs
Position
207061..207915
Genome map
AA seq 284 aa AA seqDB search
MQTIAYLGPPGTFSEEAALAYAAGREARLLPLASIPAVVTAIETEAATVGVLPIENLLEG
SVSYTLDLLIHETNLQIAGEIVVPIRQYLLARPGLQLSDIKVLYAHPQSLAQCRRFVERC
LPGVATVASLSNSAAPAEAMADERPAAAIGTLRAAELVGATILAREIADSPHNVTRFIVL
AREDAPPTGDDKTSFCFGFTREDRPGSLVSALQELAVENINMTKLESRPTRAILGQYIFL
VDINGHRREPHVARALERIRLHTGMLKIFGSYPRWRGANGNHAS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccattgcctacctcggcccaccgggaaccttcagcgaagaagcagcgcttgcc
tatgccgcagggcgcgaggcacgactgctgccgctggccagtattccggctgtggtcaca
gccattgaaacggaagcggcaaccgttggggtgttgccgattgaaaacctgttggaaggt
agcgtcagctatacgcttgatctgctgatccacgagacgaatttgcaaatcgccggcgag
attgttgtgccaattcgccagtatctcctggcccgacccggtttacaactgagcgatatt
aaagtgctgtacgcgcatccgcaatcactggcccagtgtcggcgctttgttgagcgctgc
ctgcccggcgtggctaccgtcgcttcgctgagcaattcggctgcccccgccgaggcgatg
gctgatgaacgtccggcggcggcaattggcacactgcgcgcagccgaactggtcggtgca
acgatcctggcccgtgagattgccgatagccctcacaatgtgacgcgcttcattgtgctg
gcccgcgaagatgccccgcccaccggtgatgacaaaaccagtttctgttttgggttcacc
cgcgaggatcgacccggcagtctggtgagcgccctccaggagctggccgtcgaaaatatt
aatatgacgaagctcgaatcgcgcccaacccgtgcgattcttggtcaatacatctttctg
gttgacatcaatggacaccgccgcgaaccacacgttgcccgtgccctcgaacgcattcgc
ctgcatacgggcatgctgaaaatctttggtagctatccgcgctggcgtggcgctaatggt
aatcatgcgtcgtag

DBGET integrated database retrieval system