KEGG   Chloroflexus aurantiacus: Caur_0321Help
Entry
Caur_0321         CDS       T00639                                 

Definition
(RefSeq) restriction endonuclease R XbaI
Organism
cau  Chloroflexus aurantiacus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI SPOR
Motif
Other DBs
NCBI-GeneID: 5827664
NCBI-ProteinID: YP_001633961
UniProt: A9WD03
LinkDB All DBs
Position
409856..410476
Genome map
AA seq 206 aa AA seqDB search
MESVTDKIRSLASKYAQELQHKIETRTKELESDDQSHYLIYKVLGIQDDEGRLIDLYQNK
GRFLYKYAGAFLEEATFLCFKERFPHARRAQVENTSGQRPRQFHIDCLIDREAIEIKWRD
ATTDGDHIIKEHARIKVIKDHGFYPVRVMFFYPNREQAKRIQETIKTVYQGIGGACYTGD
DAWEYVRTRTGIDLKVILVNIAKDLQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgttacagacaaaattcgttcattagcatcaaagtatgctcaagagctacaa
cacaagatcgaaactcgcaccaaagaattagaaagcgacgatcaatcacactatctgata
tataaagttctaggaatacaagatgatgaaggaagattaattgatctgtatcaaaacaaa
ggacgatttctttacaaatatgccggcgcatttctggaagaagctacctttctctgcttc
aaagaacgcttccctcatgcgagacgtgcgcaagtagagaacacatctggtcagcgtcca
cggcaatttcacatagattgcctgatagatagggaggcaatagagatcaaatggcgtgat
gctaccactgatggcgatcatattatcaaagaacatgcacggataaaggttattaaagat
cacggtttttatccagttagagttatgttcttctaccctaatcgagagcaggccaaaagg
atacaagagaccataaaaaccgtctatcagggtatcggaggagcatgttatactggagat
gatgcgtgggaatatgtaagaaccagaacaggcattgatttaaaggtgattctggtcaat
attgcaaaagatttgcaatga

DBGET integrated database retrieval system