KEGG   Chloroflexus aurantiacus: Caur_2182Help
Entry
Caur_2182         CDS       T00639                                 

Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cau  Chloroflexus aurantiacus
Brite
KEGG Orthology (KO) [BR:cau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cau03012]
    Caur_2182
   03029 Mitochondrial biogenesis [BR:cau03029]
    Caur_2182
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cau04147]
    Caur_2182
Translation factors [BR:cau03012]
 Eukaryotic Type
  Elongation factors
   Caur_2182
 Prokaryotic Type
   Caur_2182
Mitochondrial biogenesis [BR:cau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Caur_2182
Exosome [BR:cau04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Caur_2182
  Exosomal proteins of breast cancer cells
   Caur_2182
  Exosomal proteins of colorectal cancer cells
   Caur_2182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 5826640
NCBI-ProteinID: YP_001635782
UniProt: A9WFP3
LinkDB All DBs
Position
2978443..2979648
Genome map
AA seq 401 aa AA seqDB search
MAKQKFERTKPHINVGTIGHVDHGKTTLTAAITKVLSLKGAAQFMAYDQIDNAPEERARG
ITIAIRHVEYQTDKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSAPDGPMPQTREHI
LLARQVQVPAIVVFLNKVDMMDDPELLELVELELRELLSKYGFPGDEIPIVRGSARNALE
SPSKDINAPEYKCILELMNAVDEYIPTPQRAVDQPFLMPIEDVFGIKGRGTVVTGRIERG
KVKVGDTVEIVGMTNDAPRRTVVTGVEMFQKTLDEGIAGDNVGCLLRGIERTDVERGQVL
CAPGSIKPHKKFEAQVYVLKKEEGGRHTPFFSGYRPQFYIRTTDVTGAIGLPAGMEMVMP
GDNVVMTIELIVPVAIEEGLRFAIREGGRTVGAGVVTKILD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacagaaattcgagcggacaaaaccgcacatcaacgtcggcaccatcggtcac
gtagaccacggtaagacgaccctgaccgctgcgattaccaaggtgctgtcgctcaagggt
gcagctcagtttatggcgtatgaccagatcgacaacgcccccgaagagcgcgcccgtggc
attacgattgctattcgtcacgtcgagtatcagaccgacaagcgccactatgcgcacgtc
gactgccccggtcacgccgactacatcaagaatatgattaccggcgcggcccagatggac
ggcgccattctggtggtgagcgctcccgatggcccgatgccgcagacccgtgagcacatt
ctgctcgcccgccaggtgcaggtgccggccatcgtggtcttcctgaacaaggtcgatatg
atggacgacccggagctgctggagctggtcgagctggagctgcgcgagctgctcagcaag
tacggcttcccgggtgatgagattccgattgtgcgcggcagcgcccgcaacgcgctggaa
agcccgagcaaggacatcaacgccccagagtacaaatgtattctggagctgatgaatgcg
gtggacgagtacattccgacgccgcagcgggcagtggatcagccgttcctgatgccgatt
gaggacgtgttcgggatcaaggggcgcggtacggtggtgacgggccggatcgagcgcggg
aaggtgaaggtcggtgacacggttgagatcgtgggcatgaccaacgacgcgccgcggcga
acggtggtgaccggcgtggagatgttccagaagacgctggacgaagggattgctggtgac
aacgtcggctgtctgctgcgtggcattgagcgcaccgatgtggagcgcgggcaggtgttg
tgcgcaccgggcagcatcaagccgcacaagaagttcgaggcgcaggtctacgtgttgaag
aaggaagagggtggccgccacacgccattcttctcggggtaccgcccgcagttctacatt
cgcacgaccgacgtgacgggggcgattggcctgccggcggggatggagatggtgatgccg
ggcgataacgtggtgatgacgattgagctgatcgtcccggtggctatcgaagagggcttg
cgcttcgcaatccgcgaaggtggccgcaccgtcggtgctggtgttgtaaccaagatcctc
gattaa

DBGET integrated database retrieval system