KEGG   Chloroflexus aurantiacus: Caur_2911Help
Entry
Caur_2911         CDS       T00639                                 

Definition
(RefSeq) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00061  Fatty acid biosynthesis
cau00780  Biotin metabolism
cau01100  Metabolic pathways
cau01130  Biosynthesis of antibiotics
cau01212  Fatty acid metabolism
Module
cau_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Caur_2911
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Caur_2911
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Caur_2911
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cau01004]
    Caur_2911
Enzymes [BR:cau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Caur_2911
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Caur_2911
Lipid biosynthesis proteins [BR:cau01004]
 Fatty acid synthase
  Component type
   Caur_2911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 5827383
NCBI-ProteinID: YP_001636499
UniProt: A9WFC6
LinkDB All DBs
Position
complement(3901843..3902625)
Genome map
AA seq 260 aa AA seqDB search
MGLMEGKKGLILGVANDRSIAWGIAQALHREGATIGFTYLGEALERRVRPLAESLNSPLI
VPCDVSKDEDITALIEQARETFGQIDFLVHAIAFANKEELSGTILNTTREGFRIALEISA
YSLIALVKAAEPIFAPDASVLTLTYHGARQVIGSYNVMGVAKAALEASVRYLAAGLGPRG
IRVNAISAGPIRTLAASGIANFRSLHKHFAEYAPLRRNVTIEDVGNAALYLCSPLAAGVT
GEIHYVDAGFNVVVPGSGEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgatggagggaaaaaagggcctgatccttggcgtagccaatgatcgctcgatt
gcctgggggattgcgcaggcactacaccgcgagggagctactatcggtttcacgtacctt
ggtgaagcacttgaacggcgggtccgtccgctggcggaaagcctcaactcgccgttgatc
gtgccctgtgacgtgtccaaagatgaagacattaccgccttgatcgaacaggcacgtgaa
acattcggacagattgattttctcgtccacgctattgccttcgccaacaaagaagagctg
agtggcacaatcctgaacacaacccgcgaaggattccgcatcgcccttgagatcagcgca
tactcactgatcgcgctggtcaaggccgccgaaccgatctttgcccctgacgccagcgtc
ctgacattaacctaccacggtgcacgccaggtgatcggcagctacaatgtgatgggtgtc
gccaaagctgcgctggaagccagcgtgcgctatctcgctgccggtcttggcccccgtggg
atcagagtcaacgcgatcagcgccggcccgattcgcaccctggctgccagtggcattgcc
aatttccgcagcctgcacaaacatttcgccgaatatgctcccctgcggcgcaatgtcacg
attgaagatgtaggaaatgccgccctgtatctctgctcaccgctcgcagccggcgtaacc
ggcgaaatccattatgttgatgccggctttaatgtggtcgtgcccggtagcggtgaagag
tag

DBGET integrated database retrieval system