KEGG   Chloroflexus aurantiacus: Caur_3888Help
Entry
Caur_3888         CDS       T00639                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00620  Pyruvate metabolism
cau00680  Methane metabolism
cau00720  Carbon fixation pathways in prokaryotes
cau01100  Metabolic pathways
cau01120  Microbial metabolism in diverse environments
cau01200  Carbon metabolism
Module
cau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Caur_3888
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Caur_3888
   00680 Methane metabolism
    Caur_3888
Enzymes [BR:cau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Caur_3888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-GeneID: 5825698
NCBI-ProteinID: YP_001637454
UniProt: A9WDE6
LinkDB All DBs
Position
complement(5197994..5200726)
Genome map
AA seq 910 aa AA seqDB search
MQPLDQEKVDLDFTFLLDCFARVLRDVDAGPVSEALPWLGSHTPGDHIPTRALAQALIIA
FQLLNIAEENAAVQQRRVADRDPNIPPELGRWRDALQKLHQSGLTGEEIAAALPHVHVEP
VLTAHPTEAKRATVLAHYRELYLLLVRRESQRWSPAEQAEITADIETLLERLWRTGDVFL
SKPGVPAEVRNVLHYLVNVFPDVLPVLDNQLRYAWQEAGFDPALLSDTWPKLSFGSWVGG
DRDGHPLVTAEITAQTLREMRLQALRLLRRRIRQAASHLSISDLLVPTPPGLIDQIRRLS
SGLGSRGAQAVARNPNEPWRQALNLMLARLPIDDAPAEAARLVDDPDRYRCADELLNDLR
EFAGYLRAVGAGRLADAEIRPLMQLVDTFGFHLATLDVRQNSQFHDRALAQLLEAAGLSS
DDLIGGDPERRRALLEREVASPRPFAHPNTPLDYEAAAVVDSYRVLANHIARYGTAGLGP
LIISMTRDVTDVLVVYLLAREAGLAYATPEGLVCRLPVVPLFETIEDLEHSPRILADILD
HPVTRRSLIAQAQGGELVQQVMIGYSDSNKDGGILASQWALYQAQRAMTEVGRARGIRIR
FFHGRGGTISRGAGPTSRFISMLPPGSLNGDLRLTEQGEVISQKYANRLTAAYNLELLIA
GTTKHTLLQQRQPEEPHPLEPVIGWLAEKSRIAYRELVERDGFITFFRQATPIDVIEQSR
IGSRPSRRTGQATLADLRAIPWVFSWNQARFYLPGWYGVGSALTALQEQEPALWEQLRAE
QWRWPLLRYLLANVGTSLQTAHRETMHAYAGLVEDDEIRRQFLNLIDAEFTRTEAALTAI
FGMPIEQRRPRVTATLARRQIGLAPLHRRQIELLGRWRAQRAADDPAAETTLIDLLLLVN
AIAAGLRTTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccactggatcaggagaaggtcgatctggatttcaccttcttactcgattgtttt
gccagagtattgcgtgacgtcgatgccgggccggtatcggaagcattgccctggttgggt
tcgcatactcctggtgatcatattccaactcgcgcactggcacaggcactcattattgcc
tttcaattgctcaatatcgccgaggaaaacgcagcagtgcagcagcgccgggtcgctgac
cgcgatccgaatatcccgccggaattggggcgctggcgagatgccttgcagaagctgcac
caaagtggtttgaccggcgaagagattgctgcggcgcttccccatgttcacgtcgagccg
gtgctcacagcgcatcccactgaagccaaacgggcaacagtgctcgcacattatcgtgag
ctgtacttgttgctggtacggcgcgagagtcagcgctggtcgccagcagaacaggcagag
atcacggcagatattgagaccctgctcgaacgattgtggcgtaccggtgatgtctttctg
agcaagccgggtgttcctgccgaagtgcgcaatgtcctgcattacctggtcaatgtcttt
cccgatgttttgcccgttcttgataatcagttgcgctacgcctggcaggaagccggtttc
gatcctgcgctgctgagcgatacctggccaaagctcagttttggttcgtgggtcggtggt
gatcgcgacggtcatcccctggtgactgccgaaattactgcacaaacccttcgtgagatg
cgtctgcaagccttgcgtctcctgcggcgtcgaattcgacaggccgccagccatctcagt
atttctgatctgctcgttccaacgccaccggggttgattgaccagattcggcggttgtcg
agtggtttaggtagtcgtggtgcgcaggcagtggcgcgtaaccccaatgaaccgtggcgg
caggcgctgaacctgatgctggctcgtctgccaatagacgatgcgccggctgaagcagca
cggctggtcgacgatcctgatcgttatcgttgtgccgatgaactgctcaatgatctgcgc
gagtttgccgggtatttacgtgcagtaggggccgggcgactggccgatgccgagattcgt
ccattgatgcaactggttgacacctttggctttcatctggctacacttgatgttcgccag
aacagccagtttcatgatcgggccctggcgcagttattggaagctgctggcttgtcgtct
gacgatctgattggtggtgatcctgagcgacggcgggcactgttagaacgcgaggttgct
tcaccacggccatttgctcaccccaacacaccgcttgactatgaggcagcggcagtcgtt
gacagctatcgtgttcttgccaatcacattgctcgctacggtacagccggccttggtccg
ctcatcatcagcatgacacgcgatgtaactgatgtcctggtcgtgtatctgctggcgcgt
gaagccggtctggcatatgctaccccagagggtctggtgtgtcgattgccggtcgttcca
ttgtttgagacaatcgaagatctcgaacatagcccccgcattctggctgatattctcgac
cacccggtgacgcgccgtagtttgatcgcccaggctcagggtggggagttagtgcagcag
gtgatgattggctatagcgatagcaacaaagacggcggcatcctggccagtcaatgggca
ttgtatcaggcccagcgggcaatgacagaagtgggacgggcacgtggaatacggattcgt
ttcttccatggccgtggtggcacgatcagtcgtggcgccggacccaccagccgcttcatc
tcaatgctgccaccgggaagtttgaatggtgatcttcgtcttaccgagcaaggcgaggtc
atttcgcaaaagtatgccaatcgccttaccgctgcgtacaacctggaactgctcattgcc
gggacaaccaagcatacattactccagcaacggcaacccgaagagccgcatccgctggag
ccggtgatcggctggctggctgagaagtcacgtattgcctaccgcgaactggttgaacgc
gatggcttcattaccttcttccgtcaggccacgccgattgatgtcattgaacaaagccgg
atcggctcacgtccatcgcggcgtaccgggcaggcgacgctggccgatctgcgagccatc
ccctgggtctttagctggaatcaggcccgcttttatctgccgggctggtacggggttggt
agtgcattgacggccttgcaagaacaggaaccggcgttatgggagcaactgcgtgcagag
cagtggcggtggccgttattgcgttacctgctggccaatgttgggacgagtttgcaaacg
gcacaccgcgagacaatgcatgcgtatgccggcctggtcgaagatgacgagatacggcga
caattcctcaacctgattgatgcggagtttacccgtacagaagcggcattgacagctatt
ttcggtatgccgattgagcagcggcgcccacgggttaccgcgacactggcccggcgccaa
attggcctggcccctctgcatcgccggcagatagagctgctgggtcggtggcgtgcccag
cgggcggctgatgatccggcagccgaaaccacattgatcgatctgctactgctggtcaac
gcgattgcagccggcctgcgcacaaccggatga

DBGET integrated database retrieval system