KEGG   Caulobacter sp. FWC26: CSW63_06855Help
Entry
CSW63_06855       CDS       T05901                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cauf  Caulobacter sp. FWC26
Brite
KEGG Orthology (KO) [BR:cauf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CSW63_06855 (ahpF)
Enzymes [BR:cauf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CSW63_06855 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Glutaredoxin K_oxygenase FMO-like NAD_binding_8 Thi4 DUF3467
Motif
Other DBs
NCBI-ProteinID: AZS20392
UniProt: A0A3Q9II43
LinkDB All DBs
Position
complement(1123094..1124677)
Genome map
AA seq 527 aa AA seqDB search
MLDAGLKAQLTTYLQNLRQPIALVASLDDSQGSAEMKALLEDVASTSDKVSVTFDGADAR
KPSFAITRAAGDADVRFAGLPLGHEFTSLVLALLHVGGHPPRLDAEVIERIKALDGDYSF
ETYFSQSCQNCPDVVQALNTMSALNPRIRHVAIDGALFKAEVEARQVMAVPTILLNGQPF
GQGRMDVEQILAKLDTGAADRMAEKIKAKDAFDVLVVGGGPAGAASAIYAARKGIRTGVA
AERFGGQMLDTMDIENFISVPHTEGPKLATALEQHVKDYEVDVMNLQKAVGLIPAKTPGG
LHEIKLENGASLKSRTIILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVKIVTSAMTTEIHGDG
SKVNGLTYKDRNSDAPHRVDLEGVFVQIGLVPNTEWLKDSGVALSPRGEIEVDYRGETTI
PGVFAAGDATVTPYKQIIIAMGEGAKASLSAFDYLIRLPAAEAAEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccggtctgaaagcccaactgaccacctatctgcagaacctgcgccagccg
atcgcgctcgtcgcctcgctggacgactcccaaggctcggccgagatgaaggccctgctg
gaggacgtcgcctcgacctccgacaaggtcagcgtgaccttcgacggcgccgacgctcgc
aagccctcgttcgccatcacccgcgcggcgggcgatgctgacgtgcgcttcgccggcctg
ccgctgggccacgagttcacatcgctggtgctggcgctgctgcacgtgggcggccacccg
ccgcgcctcgacgccgaggtgatcgagcgcatcaaggccctggacggcgactacagcttc
gagacctacttctcgcagtcgtgccagaactgccccgacgtggtgcaggcgctgaatacg
atgagcgcgctcaacccgcgcatccgtcacgtcgccatcgacggcgctctcttcaaggcc
gaggtcgaggcgcgccaggtcatggcggtgccgaccatcctgctgaacggtcagccgttc
ggccagggccgcatggacgtcgaacagattctggccaagctggacaccggcgcggccgac
cgcatggccgaaaagatcaaggccaaggacgccttcgacgttctggtggtcggcggcggg
cccgccggcgcggcctcggcgatctacgccgcccgcaagggcatccgcaccggggtcgcg
gccgagcgcttcggcggccagatgctggacaccatggacatcgagaacttcatctcggtg
ccgcacaccgaaggccccaagctggccaccgccttggaacagcacgtcaaggactacgaa
gtcgacgtgatgaacctgcagaaggccgtgggcctgatcccggccaagacgccgggcggc
ctgcacgagatcaagctcgagaacggcgccagcctgaagtcgcgcacgatcatcctgtcg
accggcgcccgctggcggaacgtcaacgtgcccggcgaggccgagtacaagaacaagggc
gtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaacagcggcgtcgaggcggccatcgatctggccggcatcgtcgctcacgtc
acgctgatcgagttcgacagccaactgcgcgccgacgccgtgctccagcgcaagctggcc
agcctgccgaacgtcaagatcgtcacctcggccatgaccaccgagattcacggcgacggc
tccaaggtgaatggcctgacctacaaggaccgcaacagcgacgcgccccaccgcgtcgac
ctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgaatggcttaaggactcc
ggcgtggcgctgtcgccgcgcggcgagatcgaggtcgactatcgcggcgaaaccacgatc
cccggcgtcttcgccgccggcgacgcgacggtgacgccctacaagcagatcatcatcgcc
atgggcgaaggcgccaaggcctcgctctcggcgttcgactatctgatccgcctgcctgcg
gcggaggctgcggaagcggcttaa

DBGET integrated database retrieval system