KEGG   Caulobacter sp. FWC26: CSW63_07100Help
Entry
CSW63_07100       CDS       T05901                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
cauf  Caulobacter sp. FWC26
Brite
KEGG Orthology (KO) [BR:cauf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CSW63_07100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AZS20437
UniProt: A0A3S9VD19
LinkDB All DBs
Position
1173376..1174143
Genome map
AA seq 255 aa AA seqDB search
MDPTLLTAALSGALVALLLTLFGGGGSVLATPLLLYVVGVRDPHVAIGTSAAAVAVNAAV
GLAAQAKAGRVKWPCALTFGAPGLVGSLLGAHLAKAVNGQHLLAWFALAMAAVGLSMFRA
PSSPGDPDVQIDSAKASRLVPVGAATGLAAGFFGIGGGFLIAPGLMAATGMTLANAAASS
LVSVTLFGAATSLSYAASGLVDGRLFPALIVGGAGGVAIGAQLAPRLAARALLARRLFAV
MIVATAGYVAWRALA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggaccccaccctgctgaccgccgctctgagcggcgcgctggtcgcgctgctgctgacc
ctgttcggcggcggcgggtccgtgctggctacgccgttgctgctgtatgtcgtcggcgtg
cgcgacccgcacgtggcgatcggcacctcggctgccgccgtggccgtcaacgccgccgtg
ggcctggccgcccaggccaaggccgggcgtgtcaaatggccctgcgccctgaccttcggc
gcgcccggcctcgtcggttcgctgctgggagcgcatctggccaaggccgtcaatggccag
catctgctggcctggttcgccctggccatggcggcggtgggcctgtcgatgttccgcgcg
cccagctcgccgggcgatcccgacgtccagatcgactcggccaaggcctcgcggctggtc
ccggtcggggcggcgacggggctggccgccggcttcttcggcatcggcggcggctttctc
atcgcgccgggcttgatggcggcgaccggcatgaccctggccaatgcggcggcctcgtcg
ctcgtctcggtcaccctgttcggggcggcgaccagcctcagctatgccgcctcgggcctg
gtcgacggccggctgttcccggccctgatcgtcggcggcgccggcggcgtggcgatcggc
gcccagctcgccccgcgcttagccgctcgggccctgctggcgcggcgtctgttcgccgtg
atgatcgtcgccacggcgggctatgtcgcctggcgcgcgctggcgtga

DBGET integrated database retrieval system