KEGG   Caulobacter sp. FWC26: CSW63_08540Help
Entry
CSW63_08540       CDS       T05901                                 

Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cauf  Caulobacter sp. FWC26
Pathway
cauf00240  Pyrimidine metabolism
cauf00250  Alanine, aspartate and glutamate metabolism
cauf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cauf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CSW63_08540
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CSW63_08540
Enzymes [BR:cauf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CSW63_08540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AZS20691
UniProt: A0A3Q9IG63
LinkDB All DBs
Position
complement(1497357..1498355)
Genome map
AA seq 332 aa AA seqDB search
MTASAHDPAREAIETIRARVFAFPKRHFLSAGDLNAPQAADLLDLADAFVALNRQTSKTL
DILKGRTLMNLFFENSTRTQSSFELAGKRLGADVVNMNPKTSSVAKGETLIDTAVTLNAM
RPDLLVVRHASSGAASLLSQKVSGHVVNAGDGQHEHPTQALLDALSIRRAFGRVSGLTVA
ICGDVLHSRVARSNVALLHTLGASVRLVGPPTLMPAQAERWGVAVHHDMKSGLAGADVVM
MLRLQLERMQGAFVPSTREYFRFYGLDREKLSRAAPGAKVMHPGPMNRGVEIDSDVADDP
AVSLIQDQVEMGVAARMAVLTSLAARIEEAGR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggcttccgcccatgaccccgcccgcgaggcgatcgagacgatccgcgcccgcgtc
ttcgcctttcccaagcgccatttcctgtccgcaggcgatctgaacgcgccgcaggccgcc
gatctgctggatcttgccgacgccttcgtcgccctgaaccggcagacctccaagaccctc
gacatcctcaagggtcggacgctgatgaacctgttcttcgagaacagcacccgcacccag
agctcgttcgagctggcgggaaagcgtctgggcgccgatgtcgtcaacatgaaccccaag
acctcgtcggtcgccaagggcgagaccctgatcgacacggccgtcaccctaaacgccatg
cggcctgacctcttggtcgtccgccacgcctcgtcgggcgcggccagcctgctcagccag
aaggtcagcggccacgtggtcaacgccggcgacggccagcacgagcacccgacccaggct
ctactcgacgccctgtcgatccgccgcgcctttggccgcgtgtcgggcctgacggtggcg
atctgcggcgacgtgctgcacagccgggtggcccgctcgaacgtcgccttgctgcacacc
ctgggcgccagcgtgcgcctggtgggaccgcccaccctgatgccggcccaggccgagcgc
tggggcgtcgccgtccaccacgacatgaagtcgggcctggcaggcgccgatgttgtcatg
atgctgcgcctgcagctggaacggatgcagggcgccttcgtgccgtccacgcgcgagtac
ttccgcttctatggccttgaccgcgaaaagctttcccgcgccgcgcccggcgccaaggtc
atgcaccccggcccgatgaaccggggggtcgagatcgactccgacgtcgccgacgacccg
gccgtcagcctgatccaggaccaggtcgaaatgggcgtcgccgcccggatggcggtgctc
accagcctcgcggcgcggatcgaggaggctgggcgatga

DBGET integrated database retrieval system