KEGG   Caulobacter sp. FWC26: CSW63_10760Help
Entry
CSW63_10760       CDS       T05901                                 

Definition
(GenBank) nitronate monooxygenase
  KO
K02371  enoyl-[acyl-carrier protein] reductase II [EC:1.3.1.9]
Organism
cauf  Caulobacter sp. FWC26
Pathway
cauf00061  Fatty acid biosynthesis
cauf01100  Metabolic pathways
cauf01212  Fatty acid metabolism
Module
cauf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cauf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CSW63_10760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cauf01004]
    CSW63_10760
Enzymes [BR:cauf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CSW63_10760
Lipid biosynthesis proteins [BR:cauf01004]
 Fatty acid synthase
  Component type
   CSW63_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO IMPDH FMN_dh ThiG His_biosynth Glu_synthase DHO_dh G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: AZS21088
UniProt: A0A3S9VEU5
LinkDB All DBs
Position
1951000..1951935
Genome map
AA seq 311 aa AA seqDB search
MTNRVLAHTGAKYPIIQAPMGWIARYQLASAVSRAGGLGIIETSSGETENCKAEITKMAE
TGLPFGVNLPIMFLRDDAMLRFVCDSGVKFVTTSAGSPAKFIGPLKDAGIVVYHAVPTVD
AAVKCVEVGVDGLVVEGAEGGGFKNPEEVSTLVLLQAIREKVDVPLVAAGGICDGRGMAA
AFALGAEAVQMGTRFVSSAESPVHANYKAAITGAKETGTWVLNKKASPCIRAIKSELTKE
IYDAGVMPPDVLKNILGVYFGGDMEAAPALAGQTVGLINEVKSAQDIIDETVAQFHQITG
RLGALAASRGF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccgcgtgctcgcccataccggggcgaagtatccgatcatccaggcccccatg
ggctggatcgctcgctaccaactggccagcgcggtctcccgcgctggcggcctgggcatt
atcgagacctcgtccggcgagaccgagaactgcaaggccgagatcaccaagatggccgag
accggtttgcccttcggggtgaacctgccgatcatgttcctccgcgacgacgccatgctc
cgcttcgtctgtgacagcggggtcaagttcgtgacgacctcggccggcagtcccgccaag
ttcatcggcccgctcaaggacgccggcattgtcgtctaccacgccgtgccgaccgtcgac
gcggcggtcaaatgcgtcgaggtcggcgttgatggtctcgtcgtcgaaggcgctgaaggc
ggcggattcaagaacccagaggaggtctcgactctggttctgctgcaggccatccgtgag
aaggtggatgtgccgctcgtcgccgccggcggcatctgcgacggacgcggcatggccgcc
gccttcgccctcggcgccgaggccgtgcagatgggcacgcgcttcgtcagctcggctgag
agccctgtgcacgccaactacaaggctgcgatcaccggggcgaaggagactggcacctgg
gttctgaacaagaaggccagcccctgtatccgggccatcaaatccgagctgaccaaggaa
atctacgacgctggcgtcatgccgccggacgtgctgaagaacatcctcggagtctatttc
ggcggcgacatggaggccgccccagccctcgctggccagaccgttggcctcatcaatgag
gtgaagtcagcccaagacatcatcgacgagaccgtcgcccagtttcatcaaatcacaggg
cgtctcggcgccctggccgccagtcgcggcttctag

DBGET integrated database retrieval system