KEGG   Caulobacter sp. FWC26: CSW63_16120Help
Entry
CSW63_16120       CDS       T05901                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
cauf  Caulobacter sp. FWC26
Brite
KEGG Orthology (KO) [BR:cauf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cauf03110]
    CSW63_16120
Chaperones and folding catalysts [BR:cauf03110]
 Heat shock proteins
  HSP33
   CSW63_16120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AZS22033
UniProt: A0A3S9VHC3
LinkDB All DBs
Position
complement(3056135..3057046)
Genome map
AA seq 303 aa AA seqDB search
MTDIASDTGVLDDVVSAFQIENLPVRGRVVRLGAAIDEVLTRHDYPEPVANLLGEACALA
ALVGSSLKFEGRLIVQAQGDGPVRYVVVDYDTSGGLRGYCRFDPDEVAAVSDGFVRPGAK
TLLGGGVFIMTLDQGPDMDRYQGVTPIEGETLALCAEQYFAQSEQTPTRVRLAVGQVDTG
EGATWRAGGILIQVIAGDQARGETQDAWTHVQALFETTGEDELIDPTVSTPTLLWRLFNE
DGVRLLDEKPLRAFCRCSEDRIGVVMDSFSAEEVAEMVEPDGKIHVTCEYCSRVYKLDPP
TGV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcgcttccgacactggcgtcctcgacgacgtcgtttccgcgttccagatc
gagaacctgcccgtccgtgggcgggtcgtgcgccttggcgcggcgatcgacgaggtgctg
acgcgccacgactatcctgagccggtggccaacctgctgggtgaggcctgcgctctggcg
gcgctggtcgggtcgagcttgaagttcgagggacgacttatcgtccaggcccagggcgac
ggtccggtgcgctatgtcgtcgtcgattacgacaccagcggcggcctgcgcggctattgc
cggttcgatcccgatgaggtggcggcggtttcggacgggtttgtgcgccccggcgccaag
accctgctgggcggcggcgtgttcatcatgaccctggaccaaggtccggatatggaccgc
taccagggcgtgacgccgatcgagggcgagaccctggcgctttgcgccgaacagtatttc
gcccagtcggagcagacgccgacgcgcgttcgtctggcggtggggcaggtcgacaccgga
gaaggcgcaacctggcgcgcgggcggcattctgatccaggtcatcgccggcgatcaggcg
cggggcgagacgcaggacgcctggactcacgtccaggctctgttcgagacgaccggcgag
gacgagttgatcgacccgaccgtgtcgacgccgacgctcttgtggcgcctgttcaacgag
gacggcgtgcgcctgctcgacgaaaagccgctgcgggccttctgccgttgttccgaggat
cgcatcggcgtggtgatggactcgttctcggccgaggaagtcgccgagatggtcgagccc
gacggcaagatccacgtgacctgcgagtactgctcgcgggtctataagttggatccgccg
acaggggtttaa

DBGET integrated database retrieval system