KEGG   Caulobacter sp. FWC26: CSW63_20065Help
Entry
CSW63_20065       CDS       T05901                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
cauf  Caulobacter sp. FWC26
Pathway
cauf00521  Streptomycin biosynthesis
cauf00562  Inositol phosphate metabolism
cauf01100  Metabolic pathways
cauf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cauf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CSW63_20065
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CSW63_20065
Enzymes [BR:cauf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     CSW63_20065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AZS23535
UniProt: A0A3S9VLY4
LinkDB All DBs
Position
3890699..3891469
Genome map
AA seq 256 aa AA seqDB search
MIEAARKAARGLARDFGEVTELQVSKKGAADFVTNADIKAEQTLFELLTKARPGYGFLGE
ERGMVEGTDKTHTWIVDPLDGTTNFMHAIPHFAVNIALQREGEGIVAGVTYNPITNDLFW
VEKGKGAFLGAEKRLRVAARRQLDEAVLATGVPFAGKPGHGQFLKELHQVSQKVAGVRRF
GAASLDLAWVAAGRFDAFWERNLNSWDVAAGVLMIQESGGKITTIDENDHDVVQGKSILA
SNQDLHPQILERLRAA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagcggctcggaaggccgcccgtggcctggctcgtgacttcggcgaagtcacc
gaactgcaggtctccaagaagggcgcggcggatttcgtcaccaacgccgacatcaaggcc
gaacagaccctgttcgagctgctgaccaaggcgcgtccgggctacggcttcctgggcgaa
gagcgcggcatggtcgaaggcaccgacaagacccacacttggatcgtcgacccgctggac
ggcaccaccaacttcatgcacgcgatcccgcacttcgcggtgaacatcgccttgcagcgc
gagggcgaaggcatcgtcgccggcgtcacctacaaccccatcaccaacgatctgttctgg
gtcgaaaagggcaagggcgccttcctcggcgccgaaaaacgcctgcgcgtcgccgcgcgt
cgccagctggacgaagcggtcctcgccaccggcgtgccgttcgccggcaagccgggccac
ggccagttcctgaaagagctgcatcaggtcagccagaaggtcgccggcgtccgtcgcttc
ggcgcggcctcgctcgatctggcctgggtcgccgccggtcgcttcgacgctttctgggag
cgcaacctcaacagctgggatgtcgcggccggcgtgctgatgatccaggagtcgggcggc
aagatcaccacgatcgacgagaacgatcacgacgtggtgcagggcaagtcgatcctggcc
agcaatcaggacctccacccgcagatcctggaacgcctgcgggcggcttaa

DBGET integrated database retrieval system