KEGG   Candida auris: CJI97_003243Help
Entry
CJI97_003243      CDS       T04850                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
caur  Candida auris
Brite
Enzymes [BR:caur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     CJI97_003243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3
Motif
Other DBs
NCBI-GeneID: 40028389
NCBI-ProteinID: XP_028890478
LinkDB All DBs
Position
Unknown
AA seq 438 aa AA seqDB search
MNKPPRSLRLKSALGLLVGYTSFEAYMHLRTQHIIRARKKEHEAAIESEDVSKFKSATIN
GMFVNPFDEYRPQTGFEFLWVRLSELVESFYGNKIEIHDKYPTPEGDFKEVDDMLKTFRP
NYELLRENSKILQQCTASGNFDKLREKKNGVSLHDQLLFTWLGQSCSLVQISGINILTDP
IFSDHLFTPHFGPKRLVKSPMTLSDVNYATNNKLDFVLVSHNHPDHLDLDAVERISNRAT
WIVPLGLKSVLAKRGIYRVVELDWWDKVSLNKLICESPNFKDDYEIVCVPAMHWSGRHIT
DSNQSLWGSFILRRNGHSLLYHAGDTGFCRELFEMIAKLYGPVTLSMLPIGQYCPEWHQS
PRHISPEESIKIAQILQTKFALGIHFGTFKLSSEPILEPKNKLLDLAKHIGKANDYKVPE
FGLTYSYHLHNGDHLKHF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccgccgaggtctctccgactcaaatcggcgcttgggcttcttgtagggtac
acctctttcgaggcgtacatgcatctacgaacccagcacattataagggcgagaaagaaa
gagcatgaagcggccattgagctggaagacgtctccaaattcaagtctgctacaatcaat
ggaatgtttgtgaacccttttgatgaatatagaccacaaaccggatttgaatttctctgg
gtgcgtttgctggagctcgtcgagagtttctacggcaacaaaatcgagatccacgataaa
tatcccactccagagggagacttcaaggaagtggatgatatgctcaagacgtttagaccg
aattacgagcttcttcgggagaattctaaaattctacaacaatgtaccgcgctgggcaat
tttgataagcttcgggaaaagaagaatggtgtatccctacatgaccagctactcttcact
tggctaggccagtcttgttcgcttgttcagatctcggggattaatattttgacagaccca
atttttagtgaccatttgttcacaccgcattttggaccaaagcgtcttgtcaaatcgccg
atgacattgagtgatgtgaactatgcgacgaacaacaagctagactttgttttggtctcg
cataaccatcctgatcatcttgaccttgatgctgtggagcgcataagtaacagagccaca
tggattgtgcccttgggactcaagctggtattggcaaaacggggcatctatagagtggtc
gaattggactggtgggataaggtctcccttaacaagctcatatgtgaaagccctaacttc
aaggatgactatgagattgtctgcgtgccagcaatgcactggtctggacgacacatcact
gactcaaaccagtcgctctggggttcttttatccttaggagaaatggccactctctcctt
taccatgctggcgacactggattttgccgtgagttgtttgagatgattgctaaattgtac
gggcctgtaacacttctgatgcttccaatcggccagtactgtcctgaatggcatcaactg
cctcgccatatactgccggaggagagtataaaaattgcgcagatcttacaaacgaagttt
gccttggggattcatttcggaacgttcaagcttagctctgagccgattcttgaaccaaag
aacaagctacttgatttggccaagcatataggcaaggccaacgactacaaagtgcccgaa
ttcggtctcacgtactcataccatctccacaacggcgaccaccttaaacacttttag

DBGET integrated database retrieval system