KEGG   Candida auris: CJI97_003342Help
Entry
CJI97_003342      CDS       T04850                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
caur  Candida auris
Pathway
caur00040  Pentose and glucuronate interconversions
caur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CJI97_003342
Enzymes [BR:caur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     CJI97_003342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 UDPG_MGDP_dh_N Methyltransf_11 2-Hacid_dh_C Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 40028488
NCBI-ProteinID: XP_028890574
LinkDB All DBs
Position
Unknown
AA seq 369 aa AA seqDB search
MTIENPAFVLKSIKNVTFEDRPIRPLQPKEVRVHVQHTGICGSDVHYWQQGRIGKYKLEE
GKDMVLGHESGGTVVEVGSEVTALKKGDRVAMEPGVPCRFCQLCRDGKYNMCEDIHFAAT
PPWDGTLQRYYNIAYDYCYKIPDHMDMEEAALVEPVSVAVQAMKRAQLKGTDSVVVFGCG
PIGLLCQAVAKAFGCMKVIGVDISEGRLEFAKTFGADGVYKMPPKKEKEGPEEYATRVSD
EMKEEFSLGSSGADVILEATGAEPCIQVGVYLAKHEGTFVQTGMGREFVGFPVIEALVKQ
LNWTGTIRYTTGCYPTAIDLVASGKIDVKRLVTNRFKFEDAEKAFNLVKEGRTDVIKVMI
AGVTDETAI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaaacccagcattcgttctcaaatcaatcaaaaacgtcacctttgaagac
agacccattcgtccattgcagcctaaggaagtgagggtccatgtccaacacactggcatt
tgtggaagtgacgttcactattggcagcagggaagaataggcaaatacaaattggaggag
gggaaagatatggtgttgggccacgagctgggcggtactgtcgtggaagttggctctgaa
gtgaccgcattgaagaaaggtgacagagtcgctatggagcctggtgtgccttgtcgcttc
tgtcaactttgtcgtgacggaaagtacaacatgtgtgaagacatacactttgcggccact
cctccttgggatggaactttgcagcgctactacaacatcgcctacgactactgttacaag
atcccagaccacatggacatggaagaggccgcgttggtggagccagtcagtgttgccgta
caggccatgaaaagagctcaattgaagggcactgactcggtggttgtgtttggatgcggg
cccattggcttattgtgccaggctgtggctaaagcttttgggtgtatgaaagtcattggg
gtagacatttccgagggacgtttggagtttgcaaagacttttggtgctgatggtgtctac
aaaatgccgcccaaaaaggagaaagagggtcccgaagagtatgccactcgtgtgtctgat
gagatgaaggaggaattctctctaggaagttctggcgccgatgtgatcttggaggcaaca
ggggcagagccttgtattcaagttggtgtttatttggcaaagcacgaaggcacgtttgta
caaactggtatgggaagagagtttgtcggcttcccagttatcgaagcgttggtcaagcag
ctcaattggacgggtacaatcagatacaccaccggctgttaccctacagcaattgacttg
gtcgcctcaggtaagattgatgtgaagaggctcgtgactaatcggttcaagtttgaggac
gccgagaaggcgtttaatttggtcaaagagggtaggacagatgtgatcaaggtgatgatc
gctggtgtcacagacgagactgcaatttga

DBGET integrated database retrieval system