KEGG   Candida auris: QG37_02141Help
Entry
QG37_02141        CDS       T04850                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
caur  Candida auris
Pathway
caur00020  Citrate cycle (TCA cycle)
caur00480  Glutathione metabolism
caur01100  Metabolic pathways
caur01110  Biosynthesis of secondary metabolites
caur01130  Biosynthesis of antibiotics
caur01200  Carbon metabolism
caur01210  2-Oxocarboxylic acid metabolism
caur01230  Biosynthesis of amino acids
caur04146  Peroxisome
Module
caur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
caur_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:caur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    QG37_02141
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    QG37_02141
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    QG37_02141
Enzymes [BR:caur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     QG37_02141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh IDH
Motif
Other DBs
NCBI-GeneID: 28875926
NCBI-ProteinID: XP_018170974
UniProt: A0A0L0P5D4 A0A2H0ZLU3
LinkDB All DBs
Position
Unknown
AA seq 421 aa AA seqDB search
MLRGFKNTRTFSSSTAALGKIKVKNPVVEMDGDEMTRIIWARIKDKLVNPYLDVDLKYYD
LGIEARDKTNDQITVDAANAIKEHGVGIKCATITPDEARVAEFKLKKMWLSPNGTIRNIL
GGTVFRESIIIPRIPRLVPGWEKPIVIGRHAHGDQYKATDLVIEEPGKLELVFTPKNGGE
KVTKTVYDYKDRGVGLAMYNTDESIRGFAHSSFKMALSQNLPLYLSTKNTILKKYDGRFK
DVFQEIYDAEYSKQFEEKGLWYEHRLIDDMVAQMIKSKGGFVMALKNYDGDVQSDIVAQG
FGSLGLMTSALMTPDGKAYESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGLAQRG
RLDGTPEVVDFAHKLEKATVGVVQEDGVMTKDLALACGRTDRESYVTTTEFLDAVGDKLK
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaggttttaaaaatacccgcacgttctcgtcgtctactgcagcactcggtaag
atcaaagtgaagaatcccgtggtcgaaatggacggtgacgagatgacgaggatcatttgg
gcaagaatcaaagacaaattggtaaacccatacttggacgtcgacttaaaatactacgac
ttgggtatcgaggccagagacaaaaccaatgaccagatcacggtggatgctgccaatgcc
atcaaggagcacggtgtgggtatcaagtgtgccaccattaccccggatgaggctcgtgtg
gcagagttcaaattgaagaagatgtggttgtcgcccaatggtactattaggaatatcttg
ggcggcactgtttttagagagtcgatcatcatccctagaattcctcgtctagtgccagga
tgggagaagccaattgtcattggaagacatgcccatggagaccaatacaaggctacagat
ttggtgattgaggaaccaggcaagttggagcttgtgttcacccctaaaaatggaggtgag
aaggtgaccaagactgtttatgattacaaagacaggggtgtcggcttggccatgtacaac
actgatgagtccatcagaggatttgctcattcctctttcaagatggccttgagccagaat
ttgccgttatatttgtccacaaaaaacaccatcttgaagaaatacgatggtcgcttcaag
gatgtctttcaagagatttatgatgcagagtactctaagcaatttgaggagaagggcttg
tggtacgagcacagattgattgacgacatggtggcacagatgatcaagtctaagggaggc
ttcgtaatggcattaaagaactatgatggtgatgtgcaatcagatatcgtcgcccaaggt
tttggcagtttgggactcatgacctccgccttgatgactcccgacggtaaggcttacgag
agtgaggcggctcatggcacagttaccaggcattttagacagcaccagcagggcaaggag
acatccactaactctattgcttctatctttgcatggaccaggggtctcgcccaaagaggt
cgtttggatggcactccggaggttgtggactttgctcacaagttggagaaagccactgtg
ggtgtggtgcaagaagacggtgtgatgacgaaggatttggccttagcttgtggtagaacc
gatagagagtcatatgtgacaaccacagagttcttggacgctgtgggcgataagttgaag
aattag

DBGET integrated database retrieval system