KEGG   Candida auris: QG37_02393Help
Entry
QG37_02393        CDS       T04850                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
caur  Candida auris
Pathway
caur00500  Starch and sucrose metabolism
caur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caur00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    QG37_02393
Enzymes [BR:caur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     QG37_02393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 28876172
NCBI-ProteinID: XP_018170090
UniProt: A0A0L0P1W4
LinkDB All DBs
Position
Unknown
AA seq 531 aa AA seqDB search
MRFHILWPALLATSSALQIPPLASRPELQSVLLVDPKQQLDELSSTPEFEKWVSDQSVRS
FSYILENIGGVSQTLDPEKVHPGTVIASPLKVRPNYFYNWIRDSALTMRTLIYHMNDHLS
NSTSMMELRRVIEQYIEVNYRLQRVPNKSGTFNDPKRKGLGEPKFLTNGQAFDERWGRPQ
SDGPGLRVSTILGYLFFLKGNNLEIESDFLGNVTFIYNKIIKPDLEYIIANWREKLFDLW
EEIESHHFFNALTQLKALQDGQRFTQLHVMDMTFARQLQLTYHELLEYVTNSGGFTRPLV
SHIIETPEFYEKGVRSGLDAAIFLAALHAHNLEFGGTDNIPYDVDDSHILNSITAMAADM
KTRYPINIRHQTGLALGRYPEDVYDGYGTSLGNPWFISTLSAGEVLYKWIYKYTRRHADI
VIDKLNIEFFQPHDKELQNDGSLENGVIVISYNSDRYQRILKSLYKYADTFLQVVLRHVD
RHDGSMSEQFDRNTGYMQGAEKLTWSYSAFHNCVRWRTKAADQIRHLHNQE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagattccatatcttgtggccggcgcttctcgccacctccagtgcccttcagattccg
ccgttggcttctcggcccgagcttcagagcgtgcttctagttgaccccaagcagcagctc
gatgaactctccagtactcccgagttcgagaaatgggtctctgaccagtcagttcggtcc
ttctcgtatattttagagaacatcggtggtgtgtcgcaaactctagaccctgagaaagtg
catccagggacggtgattgcatcacctctgaaagtaaggccaaactacttttacaactgg
atcagagactcggccttgacgatgagaactctcatataccacatgaacgaccacctcagc
aactcaacgtcgatgatggaactcaggcgcgtgatcgagcagtacatcgaggtgaactat
agacttcagcgggttccgaacaagtcgggtacctttaatgatccgaagcgcaagggcctt
ggcgagcccaagtttctaacgaatgggcaggcgtttgacgaacgctgggggaggcctcag
tctgacggcccggggcttcgagtgtctaccattcttgggtatttgttctttctcaagggc
aacaacctagaaatcgagagcgacttcttaggaaacgtcacattcatctacaacaagatc
ataaagccagatttagagtacatcattgccaattggcgtgagaagctgtttgacttgtgg
gaggaaattgagtcgcatcacttcttcaacgccttgacccagcttaaggcattacaggat
ggacagcgatttacccagcttcacgtcatggacatgacgtttgcgaggcagcttcaactg
acataccatgagcttctcgagtatgtcaccaactcaggagggttcacgagaccattggtg
tcgcacataatcgaaacaccagaattttacgagaagggcgtgcggtcaggccttgacgcc
gctattttccttgcagcgctccatgcgcataatctagagtttggcggtacagataacatt
ccctacgatgttgacgattctcacatcttgaatagcatcaccgctatggctgctgatatg
aagacacgatacccgatcaacataagacaccaaactggactggcgttgggcagatatcct
gaggatgtgtatgacgggtatggaacttctttaggaaacccctggtttatctcgacgtta
tctgctggagaggttctttacaagtggatctacaagtacactagacgccacgctgatatt
gtaatcgataaactgaacattgaattcttccagccacacgacaaggagttgcaaaatgac
ggttcattagagaacggagtgattgtaatctcttacaactccgacaggtatcagcgaata
ctcaagagtttatacaagtatgctgacacgtttcttcaagtcgtgctgagacatgtggac
aggcatgacgggtctatgtctgagcagtttgatagaaacaccggatacatgcaaggggct
gagaagttgacgtggtcgtattcggcattccacaattgcgtgagatggagaacgaaagct
gctgatcagatcaggcacctccataatcaagagtaa

DBGET integrated database retrieval system