KEGG   Candida auris: QG37_05942Help
Entry
QG37_05942        CDS       T04850                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
caur  Candida auris
Pathway
caur00020  Citrate cycle (TCA cycle)
caur00310  Lysine degradation
caur00380  Tryptophan metabolism
caur01100  Metabolic pathways
caur01110  Biosynthesis of secondary metabolites
caur01130  Biosynthesis of antibiotics
caur01200  Carbon metabolism
Module
caur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
caur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:caur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    QG37_05942
  09105 Amino acid metabolism
   00310 Lysine degradation
    QG37_05942
   00380 Tryptophan metabolism
    QG37_05942
Enzymes [BR:caur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     QG37_05942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 28879634
NCBI-ProteinID: XP_018167274
UniProt: A0A0L0NV51 A0A2H0ZV89
LinkDB All DBs
Position
Unknown
AA seq 1015 aa AA seqDB search
MLSAFRHLKRTPSNCAHILRAQTNVQFRQHAVASRVGIVSFSRTLATDTFVLSNNSNYIE
EMYEAWRQDPKSVHVSWDAYFKNLDSGVAPSAAFSAPPTLIPTPAGGAGVGFDPGAGGHS
EDVVTHLKVQLLVRAYQVRGHQKAKIDPLGISFGDQPDLPKELTLEHYGFTERDMDKSIT
LGPGILPRFVESGKKTMTLREIIDACERLYCSSYGVEYIHIPSKEQCDWLRERIEIPQPF
KYSSDEKRQILDRLIWSCSFESFLATKFPNDKRFGLEGAEAVVPGMKAMIDTSVEHGIED
IVIGMPHRGRLNMLSNVVRKPNESIFFEFTGSKELDEGSGDVKYHLGMNYKRPTTSGKHV
NLSLVANPSHLEAEDGVVLGKTRAIQEYKSDAGEFKKAMGVLLHGDAAFSGQGVVYETMG
FANLPAYSTGGTVHIIINNQIGFTTDPRFARSTLYPSDIAKSINAPIFHVNADDIEALTF
VFNLAADWRATFHSDVIIDVVGYRKHGHNETDQPSFTQPLMYKKIAEKRSVLDYYVDKLI
SEGTFTKEDIDEHKKWVWNLLEESFGKSKEYKPTSREWLTTPWEDFKSPKELATEVLPHL
PTAVDAETLKNIGRHISETPKGFEVHRNLKRILNTRKKTVETGEGIDWATGEALAFGSLC
LEGYHVRVSGQDVERGTFSQRHAVLHDQESEKVYTPLNTLSEDQGPFVISNSSLSEYGVM
SFEYGYSLFSPDALVQWEAQFGDFANTAQVVVDQFISGAESKWKQRSGLVLSLPHGYDGQ
GPEHSSGRIERYLQMCNEDPRYFPSEQKLERQHQDCNMQVAYPTTPANLFHLLRRQMHRQ
FRKPLCLFFSKQLLRHPLAKSELKEFTGESHFEWIIEDRELGKSIHERDGISRVVLCSGQ
VYTALHKKRASLDNKNTAIIKLEQLHPFPFAQLRDTLNKYPNLEDLVYCQEEPLNMGAYS
YVAPRMVTTLKQTDKYANLVLRYAGRDPSASVAAGSKAMHNAEEEAFLKEVFQEA
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atgcttagcgctttcagacatttgaaacgtactccgagtaactgtgctcacattttgagg
gctcagaccaatgtgcaatttagacaacatgctgttgcttcgagagttggaattgttagc
ttctctcgcactttagcaactgacacatttgtgttgtcgaacaattcaaattatatcgaa
gagatgtatgaagcatggcgtcaagaccctaagtccgttcatgtatcttgggatgcctac
ttcaagaatttggactcaggggttgctccttcggctgcattctccgctccaccaacgttg
attcctactccagcaggtggtgcaggcgtcggctttgacccaggtgcggggggccatagt
gaagacgttgttactcacttgaaagtgcagcttcttgttcgtgcttatcaagtacgtggc
caccagaaggccaagatcgatcctttaggtatctcgttcggcgatcaacctgatttaccc
aaagaacttactttagagcactatggcttcactgaacgcgatatggataagtcgattacg
cttggaccaggaattttgcctcgcttcgttgaaagcggcaaaaaaacaatgacattacgg
gaaattattgatgcttgtgagcgactttattgttcttcttatggtgtagagtacattcat
ataccttcgaaagaacagtgtgactggttgagggaacgcattgagattcctcagcctttc
aagtactcatcagacgaaaaaaggcaaatcttagatagattgatctggtcttgttcgttt
gagtcatttttggctactaaatttcctaatgataagagatttggactcgaaggagcagag
gcagtcgtccctggtatgaaagcgatgattgatacttctgtagagcatggcatagaggat
atagttattggaatgccacacaggggacggttaaacatgttgtccaatgtcgttaggaag
ccaaatgagtcgatctttttcgagtttacaggttccaaagagttagacgagggctctggg
gacgtcaagtatcacttgggaatgaattacaagcgtccaacgacttctggaaaacatgtc
aacttatctcttgtcgccaatccttctcacttggaagctgaggacggggtcgttttagga
aagacaagagccatacaagagtacaaatctgatgcgggggaattcaaaaaggcgatgggc
gttttgttgcacggtgacgctgccttttctggtcaaggtgttgtttatgagacaatgggc
tttgccaatttaccagcttactccactggcggaactgtccatataatcatcaacaatcag
attggtttcaccacagacccccgctttgccagatccactttatatccatcggatattgcc
aagtccatcaatgctcccatcttccatgtgaatgctgatgatatcgaagctcttactttt
gtgttcaacttagctgctgattggagagcaacgtttcattctgatgttatcatcgatgtt
gttggctatagaaagcatggtcacaatgaaaccgatcagccatccttcacccaacctttg
atgtacaagaagatcgccgagaaaagatctgttctcgactattatgtcgataagttgatt
tcagagggcactttcacaaaggaggatatcgatgagcacaaaaagtgggtttggaatctt
ttagaggagtcttttggcaagtcaaaggaatacaagccgacttcacgtgagtggttgacc
acaccttgggaagattttaagtctccgaaggagttagcgactgaggtattgcctcacctt
ccgactgctgttgatgcagagactttgaagaacattggcagacacatctccgaaactccc
aaaggttttgaagttcacagaaatttgaagcgtattttgaacaccagaaagaagaccgtg
gaaacaggagaagggatcgattgggctacaggagaggctttggctttcggctctctttgt
ttggagggttaccatgtgagagtttctggtcaggacgtcgaaagaggaacgttctcccaa
cgtcatgcagttttacacgatcaggaatcagaaaaggtttacactcctctcaacaccttg
tctgaagaccaaggaccatttgtcatatcaaattcttcgttatccgagtacggtgtaatg
agtttcgagtatggttactcgcttttctctccggatgcgttggttcaatgggaagctcag
tttggtgatttcgcaaacactgctcaagtagtcgtcgatcaattcatttcgggcgctgaa
tcaaaatggaagcagagatctggtttagttttgtctttgccacacggatacgacggtcaa
ggcccggaacattcttctggtagaatcgagaggtatttgcagatgtgtaacgaggatcct
cgttatttcccttcggagcaaaagcttgagagacagcatcaagactgcaacatgcaagtc
gcctacccaacaacaccagctaacttatttcacttgttgaggcgtcaaatgcataggcag
tttagaaagccattatgtttattcttttcaaagcagttgttgaggcatccattggcgaaa
tcagaattgaaggagtttacaggtgagtctcattttgaatggatcatcgaagatcgtgaa
ttgggtaagagtattcatgaaagagatggaattagtcgagttgttctctgttctgggcaa
gtctacaccgctttgcacaaaaagcgtgcctcacttgataataagaacactgcgataatc
aaacttgagcagttgcatcccttcccattcgctcaattacgtgacacattgaacaaatac
cctaatcttgaagacttggtctactgtcaagaagaacccttgaatatgggcgcgtactct
tacgttgctcctcgcatggtgacgactttaaagcaaactgataagtatgcaaacttagtt
ttgagatacgccgggagggatccttcggcatccgttgcagcgggctctaaggccatgcat
aatgctgaagaagaggcatttttgaaagaagttttccaagaggcttaa

DBGET integrated database retrieval system