KEGG   Candida auris: QG37_06245Help
Entry
QG37_06245        CDS       T04850                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
caur  Candida auris
Pathway
caur00010  Glycolysis / Gluconeogenesis
caur00051  Fructose and mannose metabolism
caur00052  Galactose metabolism
caur00500  Starch and sucrose metabolism
caur00520  Amino sugar and nucleotide sugar metabolism
caur01100  Metabolic pathways
caur01110  Biosynthesis of secondary metabolites
caur01130  Biosynthesis of antibiotics
caur01200  Carbon metabolism
Module
caur_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:caur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    QG37_06245
   00051 Fructose and mannose metabolism
    QG37_06245
   00052 Galactose metabolism
    QG37_06245
   00500 Starch and sucrose metabolism
    QG37_06245
   00520 Amino sugar and nucleotide sugar metabolism
    QG37_06245
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    QG37_06245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:caur04131]
    QG37_06245
Enzymes [BR:caur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     QG37_06245
Membrane trafficking [BR:caur04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    QG37_06245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 28879932
NCBI-ProteinID: XP_018167552
UniProt: A0A0L0NUV9
LinkDB All DBs
Position
Unknown
AA seq 484 aa AA seqDB search
MVRLGPKPPQHRKGTFTGVSQELLDEIHKMEKMFTVSGETLDKISDHFASELTKGLSKAG
GNIPMIPGWVVDYPTGEEKGEYLAIDLGGTNLRVVLVSLLGNHKFDTTQSKYALPKHMRT
AKSEELWSFIADCLAKFIEEFFPDGVKSPLPLGFTFSYPASQDRITEGYLQRWTKGFDIE
GVEGKDVVPMLQDAIAKQNLPVEVVALINDTTGTLVASMYTDAETKMGLIFGTGVNGAYY
EVCGDIPKLEGRLEDDITPELPMAINCEYGSFDNELVVLPRTKYDVIIDKESPRPGQQSF
EKMISGYYLGELLRLILLELAEEKHLIFDGQDLTKLHESFIMDTSFPARIEEDPFENLSD
VQDLFQTHLNIQTTVAERKVIRRLSELLGERSARMSVCGIAAICKKRGYKTAHCAADGSV
YEKYPYFKERAAQALRDIFGWADDQEDPIVIVPAEDGSGVGAAVIAALTEQRLKEGKSVG
VKKA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggtcagattaggacccaagccacctcagcacagaaaaggcaccttcaccggtgtctcg
caagagttgctcgatgagatccacaaaatggagaaaatgttcaccgtttccggcgaaacc
ttagacaagatctcggaccattttgcctctgagttgaccaaaggcttgtccaaggccgga
ggcaatatccccatgatcccaggttgggttgttgactacccaactggtgaagaaaaaggt
gaatacttggccattgacttgggaggaaccaacttgagagtggtgttggtatctttgttg
ggcaaccacaagtttgacaccacccagtcgaaatacgctttgcccaagcacatgagaacc
gccaagagcgaggagttgtggagcttcattgccgactgcttggccaagttcatcgaggag
ttcttccctgacggagtcaaaagtcccttgcctttgggtttcaccttctcttaccctgcc
tctcaagacagaatcaccgagggttacttgcaaagatggaccaaaggcttcgacattgag
ggcgtcgaaggtaaagacgttgtgcccatgttgcaggatgccattgccaagcagaacctc
cctgttgaggttgttgctttgatcaacgacaccaccggtacgttggtggcctccatgtac
acagatgctgagaccaagatgggtcttatctttggtaccggtgtgaatggtgcatactac
gaggtctgcggtgacatcccaaagttggaaggcagattggaagacgacatcaccccagag
ctgccaatggctatcaactgcgagtatggttcctttgacaacgagctcgtggtgttgcca
agaacaaagtacgacgtgatcattgacaaagagtctccaagacctggccagcagtcgttc
gagaaaatgatctcgggttactacttgggtgagcttttgagattgatccttctcgagttg
gctgaagagaaacacttgattttcgatggccaggacttgaccaagttgcacgagagcttc
attatggatacctcgttccctgctcgtatcgaggaggacccattcgaaaacttgtctgat
gttcaggatcttttccagacccacttgaacatccagaccactgtggccgagagaaaggtg
atcagaagattgtccgagttgctcggtgagagatccgccagaatgtccgtgtgtggcatt
gctgccatttgcaaaaagagaggctacaagaccgcccactgtgctgccgacggttctgtt
tacgaaaaatacccatactttaaggagagagccgcccaggccttgagagacatctttggc
tgggccgacgaccaggaggacccgattgtcattgtgcctgctgaagatggttctggtgtc
ggtgccgctgtcattgccgccttgactgaacaaagattgaaggagggcaagtctgtcggt
gtgaagaaggcatga

DBGET integrated database retrieval system