KEGG   Candida auris: QG37_06377Help
Entry
QG37_06377        CDS       T04850                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
caur  Candida auris
Brite
KEGG Orthology (KO) [BR:caur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:caur03036]
    QG37_06377
Enzymes [BR:caur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     QG37_06377
Chromosome and associated proteins [BR:caur03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     QG37_06377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 28880064
NCBI-ProteinID: XP_018166891
UniProt: A0A0L0NSL8
LinkDB All DBs
Position
Unknown
AA seq 708 aa AA seqDB search
MPPNDREDEIEDSLITQFETTLSIRPSNEVNEAEDITIDQSTVYGKLDSDEQKSDQQISR
SKSIEKAEIIDFVQKHENDVQSNKAVLRESKETETETVDGLMRRELLKSYPGMAAMLEPS
PLIDLKLSKFERTFAEFMNANPQINQQSPRFLNEADKTLILLSPYSTEHAFGRSWVLRSY
LATIFERPQRLLASCIGVTAALSMYPFFYSIRNSERKGSIFAKHVRVVHGKLWPKTLFDM
CLKSHEKLIRKEIEVPPEWNPGDIYLTPKSITALEGVIGTIETAIDSIFGNGIDTERHNL
AFAVLRPPGHHSHACLPSGFCVLNNAQIGAEYAFQRYSVTHVAILDIDLHHGDGTQDICW
ERGGFQGDFGKNEKDEELNPTRDENGKCKPSLPKVGYFSLHDIKSYPTELGFASKENIKN
ASMCVMDHDINIWNVHLQEWLSEEEFYKHYQTKYVAILNRANQFLNQARRQYEQDSANYI
SEVAKYNKYMKKPSQFKTPVSKPTPLTPFKPFIIISAGLDASEYEDPQMQRHGINVPTSF
YARFTKDVVKLAKIHTEGKVVSFLEGGYSDAALISGVFSHLIGLTNNPEQVGDDPVLWNA
TWGNDHVVKELTKGCKRGWIPYKNPRTEVTIWANEVIKLGRLLMPNSILPANYMYNQATD
NSDDGLPVEYYSRMLRDIYDEKPSVDICYNKDVKGGRILRNNRHQAKR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaacgatcgtgaggatgaaattgaggactcattaataactcaatttgagact
acccttagtattcggccatcgaacgaagtgaatgaagctgaggatatcacgatagaccag
agtacagtttatggcaaactcgactccgatgaacaaaaatccgatcaacagatatcgaga
agcaaatccattgagaaagccgaaattatagattttgtccaaaagcatgagaacgatgtt
caaagcaacaaagctgtgttgcgagagtccaaggaaacggaaacggaaacagtagatggt
ttgatgagaagggaactcttaaaaagctacccgggcatggcagctatgcttgagccatca
ccactcattgacctaaaattgagcaaatttgagagaacttttgcagaatttatgaatgcc
aatcctcaaattaatcaacagagcccaagatttctgaacgaggccgataaaactttgatt
cttctttcaccatattctacggaacatgcatttggtcgttcttgggttctgaggtcatac
cttgcgacaatttttgagagaccacaacgattacttgcatcttgcattggtgttactgca
gcactttccatgtatccttttttttattccataagaaattctgaaagaaaaggctctatt
ttcgcaaagcatgtaagagttgtccatggcaaactgtggccgaagactttgttcgatatg
tgtttaaaatctcatgaaaagcttataagaaaagaaatcgaggttccccctgagtggaat
ccgggtgacatttatttaacccctaaaagtatcaccgccttagagggcgttatcggaaca
atagaaacagcaattgactcaatttttggtaatggtattgatacagagagacataattta
gcatttgcggtccttcgcccacctggccatcattctcatgcttgcctccccagtggtttc
tgtgtacttaacaacgctcaaattggcgctgagtatgcctttcagaggtatagtgtaact
catgttgctatacttgatatagatcttcaccacggcgacggcacccaggatatatgctgg
gagcgaggtggatttcaaggggactttggtaaaaatgaaaaggacgaggaactcaatcct
acaagagacgaaaacgggaaatgcaagccatcgcttcctaaagtcggttacttctctttg
catgacattaaatcttacccaactgagcttggctttgcatccaaagaaaatatcaaaaat
gcctcaatgtgcgtaatggatcacgacatcaatatttggaatgttcatctacaagagtgg
ctgtctgaagaagaattttacaagcattatcaaacgaagtatgtggcaattttaaatcga
gcgaatcagtttctcaaccaagcccgaaggcagtacgagcaggattctgcaaattatatc
tcagaggtcgccaaatacaacaagtatatgaaaaagccaagtcaattcaaaactcctgtg
tcaaaaccaacaccattgacgcccttcaaaccttttataattatatctgctgggctcgac
gcctcagaatatgaggatcctcaaatgcagagacatggtataaatgtaccgacatccttt
tatgctagattcactaaggatgttgtcaaattggctaaaattcatacagaaggcaaggta
gtatcatttttggaaggagggtattctgatgctgcattgatctctggggtgttttctcac
cttattggcttgactaataacccagaacaggtcggtgatgaccctgtactttggaatgca
acttggggaaatgatcatgtggtgaaggaactcacaaaaggttgcaaacgtggttggata
ccgtacaaaaacccaagaacggaagtcactatctgggcaaatgaggtaattaagttgggc
aggctgcttatgccgaattcaatcttaccagctaactacatgtacaatcaagcgacggac
aactcagatgatggcttgcctgtagagtattatagcagaatgcttcgtgacatctatgat
gaaaaaccctcagttgatatttgttacaacaaggatgtgaaaggcgggcgtattttgcga
aacaacagacatcaagccaagcgatga

DBGET integrated database retrieval system