KEGG   Candida auris: QG37_06851Help
Entry
QG37_06851        CDS       T04850                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
caur  Candida auris
Pathway
caur00730  Thiamine metabolism
caur00790  Folate biosynthesis
caur01100  Metabolic pathways
Module
caur_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:caur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    QG37_06851
   00790 Folate biosynthesis
    QG37_06851
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:caur04147]
    QG37_06851
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:caur00537]
    QG37_06851
Enzymes [BR:caur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     QG37_06851
Exosome [BR:caur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   QG37_06851
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:caur00537]
 Enzymes
  QG37_06851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 28880525
NCBI-ProteinID: XP_018166461
UniProt: A0A0L0NRE0
LinkDB All DBs
Position
Unknown
AA seq 634 aa AA seqDB search
MLVETANRIAHLNEKKKKKNSLDEDSFFPSAISEHHLSWAASSSTYYRSPAHSLADTWPL
IYANPKTSPTTTCFLKMAYIRLPTDDYVDDESLIQKEVQAVFQKPKKKPMWKALLCLIGY
LVFVSLTATLYWFLSEKDEKQNVIFMVTDGMGPASLSLARSFKQYRDNLGIDDVLALDTL
LIGSSRTRSNDSLVTDSAAGATAFSCALKTYNGAIGVDSDKNPCGTILEALKLNGWLTGL
VVTTRITDATPAAFSAHADYRFQEDLIAQHQLGEYPLGRMVDLMIGGGRCHFLPRSESGG
CRNDNRNLILEAQDKGWSYAGDREAFDELQEGKNVTLPLLSLLAPTDIPYDLDRDPKEHP
SLAEQVRVALTALSKATRKSKKGFFLLIEGSRIDHAGHHNDPAAQVREVLAYDEAMKEVM
KFVNNTSTKTTVISTSDHETGGLSTARQITESYPDYLWYPEVLLNSSHSGEYLVKKVMSK
LAELSHDRTLLQSFIAKEIIEKDMGIKDYTEEEVSAVEELSKNANKLLGFLNNMISVRSQ
TGWSTSGHSAVDVNIYAFSNSEKITQKLLQKEPYTGLLGNHENIEIGAFMSEITGADLAR
VTKLIRDTKHSPKSVHELEASSDDLHMHAVQKAH
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgctagtagaaacagcaaatcgaattgcacatctcaatgaaaaaaaaaaaaaaaagaat
tccctcgatgaagatagtttttttccctcggctatctccgaacatcatctttcctgggct
gcttcatcttcaacctactataggtcacctgcacatagcctcgccgatacatggcctctt
atctatgccaatcccaaaacttcaccaacaactacatgtttccttaaaatggcgtatata
agattaccaactgacgactacgttgatgatgagtcgctcatccagaaagaagttcaagct
gtcttccaaaaacccaagaagaagccgatgtggaaagcgcttctctgccttatcggatac
ttagtattcgtctccttgactgccactttatactggttcttgagcgaaaaagatgaaaaa
caaaatgtcattttcatggtcaccgatggaatgggtcctgcttcgttatcgcttgctcgt
tcgtttaaacaatacagagacaacctcggcattgatgatgttttggctttggacactttg
cttatcggttcgtcccgtactcgctcaaacgactctttagtgactgactctgctgctggt
gctactgccttctcatgtgctttgaagacatacaatggcgctattggcgttgactcagac
aaaaacccttgtggaacgatcttggaagctttgaagttaaatggctggctcactgggctt
gttgtgaccaccagaatcaccgatgccactccagctgctttcagtgctcatgctgactat
cgcttccaggaagacctcatcgcacagcatcaattaggcgagtacccattgggcagaatg
gtagatttgatgatcggtggtggaaggtgccatttccttcccagatcagagagcggaggc
tgtagaaacgacaatagaaatttgattttagaggcgcaagataaaggatggtcttatgcc
ggagatagagaggcttttgacgaattgcaagagggcaaaaacgtgacgttgccacttctt
tccctcttagcccccacagacattccctatgaccttgatagagatcccaaagaacaccct
tcgttggccgagcaggtgagggtcgctcttactgccttgtctaaggcgacaagaaagtcg
aaaaagggcttctttttgctcattgagggctctagaattgaccatgctggtcaccataac
gaccctgcggcgcaagtgagagaggtgttggcatacgatgaagcgatgaaggaagtgatg
aagtttgttaataacacttcgacgaaaacgacagtaatttcgacctctgaccatgaaacc
ggtggtttatccaccgctagacaaattactgaaagctacccagactacttgtggtaccct
gaagttttgctcaatagtagtcactctggtgagtatttggtgaagaaggtgatgagtaag
ctggctgaactttcccatgatagaacgttgctccaatcttttattgcaaaagaaattatt
gaaaaggacatgggtatcaaagactacaccgaagaagaggtttctgcagtagaggagctt
tctaagaatgccaacaagcttttgggattccttaacaacatgatctcagttcggtctcag
acgggttggagcacttctggccactcagctgttgatgtcaatatttatgccttctctaac
tcggagaagattactcaaaagcttttacaaaaagagccttacactggattgttgggcaac
catgaaaacattgaaattggagcttttatgtcagaaattaccggtgcagacttggcaagg
gtcactaagttgataagggacacgaagcactcaccaaagagtgtccacgaattggaagcc
tccagcgacgatttacacatgcatgctgtgcaaaaagcacactaa

DBGET integrated database retrieval system