KEGG   Candida auris: QG37_06894Help
Entry
QG37_06894        CDS       T04850                                 

Definition
(RefSeq) histone deacetylase transcription modifier
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
caur  Candida auris
Pathway
caur04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:caur00001]
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    QG37_06894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:caur03036]
    QG37_06894
Enzymes [BR:caur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     QG37_06894
Chromosome and associated proteins [BR:caur03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     QG37_06894
   HDAC complexes
    Sin3A-HDAC complex
     QG37_06894
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    QG37_06894
  Chromatin remodeling factors
   NuRD complex
    QG37_06894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 28880568
NCBI-ProteinID: XP_018166503
UniProt: A0A0L0NRX9
LinkDB All DBs
Position
Unknown
AA seq 504 aa AA seqDB search
MYVQMPFDDLKVDPTKKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKM
EIYRAKPATKQEMCQFHTDEYIDFLSRVLPDNLDMFAKEQVKFNVGDDCPVFDGLFEYCG
ISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVL
YIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGKGKHYAVNVPLRDG
IDDSTYKSVFEPVISKIMEWYQPSAIVLQCGGDSLSGDRLGCFNLSMRGHANCVNFVKSF
NVPLMVVGGGGYTMRNVARTWAYESGLLNEVNLPSELPYNEYYEYYGPDYKLDVRPSNMY
NANAPEFMNKILTNIIANLENTKHAPSVQMNDVPQDAEDLGDEEEDSPMAIDTKGGSQQA
RDERVVPDNEFYDEEDKDAGERYIGPSESSKVEKETPAAEPEHGAATTESNAQNSTEAKP
ETEKAQITEEEQKEIDELNKAAQL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttcaaatgccattcgacgacctcaaggtcgaccccaccaagaagagaagagtg
gcgtatttctatgatgccgatgttggtaactacgcttacggtgctggacatccaatgaag
ccacatcgtataagaatggcacactctttgatcatgaactacgggctctataagaagatg
gaaatctacagagcgaagccagcaaccaagcaggaaatgtgtcagtttcacacagacgag
tatattgatttcttgagcagggtgctgccggacaacttggatatgtttgccaaagagcag
gtgaagttcaatgtgggtgatgactgtcctgtttttgatggcctcttcgagtactgtgga
atttctggcggcggctccatggaaggtgctgctcgtttgaacagaggcaagtgtgacatt
gcaattaactatgctggtggattgcaccatgccaaaaaatcagaagcgtcaggtttctgc
tatttgaatgatattgtgttgggtatcatagaattgttgcgttaccacccacgtgtttta
tatatcgatattgatgtgcatcacggtgacggtgtggaagaagccttttacactacagac
agagtcatgacatgctccttccacaagtatggcgagtttttccccggtactggtgaactt
cgtgacattggtgtgggcaagggtaagcattacgctgtgaatgttccgttgagagatggt
atcgacgactcgacgtacaagtctgtttttgagccggttatctcaaaaatcatggagtgg
taccagccgtcggccattgtcttgcagtgtggtggtgactcgttaagtggcgacagactt
ggctgcttcaacttgtcgatgcgtggtcacgccaattgtgtcaactttgtcaagtcgttc
aacgtgcctcttatggtcgtcggtggtggtggatacaccatgagaaatgtcgccagaacg
tgggcctacgaatcagggttgttgaatgaggtaaacttgcccagtgagttgccatacaat
gaatactacgagtactacggaccagactacaagcttgacgtgaggccatcgaatatgtac
aacgccaatgctcctgagtttatgaacaagatcttgaccaacatcattgccaatttggag
aatactaagcacgcgccttctgtgcaaatgaatgacgttccccaagatgccgaggatttg
ggtgacgaggaggaagactctccgatggcaatcgatactaaaggtggttcgcaacaggca
agagatgagagagttgttccagataacgaattttacgatgaagaagacaaggatgctggt
gagcgttatatcggccccagcgaatcctccaaggtcgagaaagagactccagctgccgaa
cctgagcatggtgccgccacgacagagtccaatgcacaaaactcaacggaagccaagcca
gagactgagaaggcacaaataacggaggaggagcagaaagagatcgacgagctcaacaag
gcagctcagctgtag

DBGET integrated database retrieval system