KEGG   Candida auris: QG37_07853Help
Entry
QG37_07853        CDS       T04850                                 

Definition
(RefSeq) alpha-glucosidase precursor
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
caur  Candida auris
Pathway
caur00052  Galactose metabolism
caur00500  Starch and sucrose metabolism
caur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    QG37_07853
   00500 Starch and sucrose metabolism
    QG37_07853
Enzymes [BR:caur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     QG37_07853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 28881517
NCBI-ProteinID: XP_018165621
UniProt: A0A0L0NP15
LinkDB All DBs
Position
Unknown
AA seq 1010 aa AA seqDB search
MRFSLLVSAAGVGAAALNGFNSTGSQNSSFVNELLKANSTAALNTSNSFPEELTLGVSQL
PNVLNESAVDANAEAKGYRLVNVSRNACGVSGFLRLQKETDIYGYDFDVLKLKVEHQSNS
RLSVHIEPQNLTDVYKLPSELVPKPESSNASCSGLTDLLFRHSGVNELFWFEVVRKSNAE
VLFSTKGNPLVFSNQFVQFNSSLPKGHVITGLGEAIKGFTNPPGTVRTLYANDVADPVDG
NIYGVHPFYIDQRYANLNQTNVHTTPLNDTRFPGVLWGNQSNSTVSLSNSSFYEEYSPLN
KSYSHGVWWRTSAPQEVIIEEEAITWRALNGVIDLYFFSGPTPKDVIKQYVSEVGKPALQ
PYWALGYHHSRWGYSTIDDLQNVVDTFAEKDLQLETIWSDIDYMDSFKDFTNDPHRYPLD
KFLHFLDQLHDGDQHYVPIVDAAIYYPNPNNKTDADYPAFNDGNKTDVFLKNPDGSLYIG
AVWPGYTVFPDFLANNTFEWWKKTFKDWYEQIKFDGIWLDMNEVSSFCVGSCGSGKVEKN
PVHAPFQYGGLQEQFPEGFATSNATEYKQFLQFISASSNSSFSDSSNDTKSSSEEFFNWK
APGKGNINYPPYVINHAQGDHDLATHAVSPNATHADGTLEYDIHNLYGYLQTNATFHALQ
DVAPGKRPFIISRSTYSGSGAYAGHWGGDNWSNFTYAYFSIPQALTLGLAGIPFFGVDIC
GFNGNSDLELCSRWMQLGAFFPFYRNHNVLGAIDQEPYVWEDVLSHSKVTMDIRYALLPY
FYTLLHEASETGVPPLRALSWEFPDDPALSDADRQFFVGEALLVTPVLEPNVSTVKGVFP
GANVTDVYYDWYTHEKANFTDGKNETLDAPLGHIPLHIRGGHIIPMQDPGYTVAESRNNS
WNIIVPLGIEGTASGLLYYDDGDSYPIVNSTTVDFVASEGSLSASAYGDYRIEQPLSSVY
ILGVEDEPNSVKFNGQSVSFEFANNTIEVTELEDLTEKGAFYRDFTLTWN
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctcgttgcttgtgtctgctgccggggtcggagctgctgccttaaacggcttc
aactccaccggctctcaaaactcctcctttgtcaatgagcttctaaaggccaattcgacg
gcggctctgaacacttccaactcgttccccgaggagttaaccttgggcgtgtcgcagctc
cccaatgtgttgaacgagtcggctgtagacgctaatgctgaggccaagggctaccgcttg
gtcaatgtctcgagaaacgcctgtggggtttctggttttttgcgcttacagaaggaaaca
gacatatatggctacgactttgacgtgttgaagttgaaggtcgagcaccagtcgaattcg
agactctcggtgcatatcgagcctcaaaaccttactgacgtctacaagctcccctcggag
ttggttccgaagcccgaatcgtcaaatgcgtcctgttctggtctgactgatttgcttttc
agacactcgggggtcaatgagctgttttggttcgaggtggtgaggaagagtaacgccgag
gtcttattttccaccaagggcaacccgttagtgttctccaaccagtttgttcagttcaat
tcgtctcttcctaaaggtcatgttatcactggcttgggtgaggccatcaaaggtttcaca
aaccctcctggcactgtcagaacactctatgctaacgacgtcgctgaccctgtcgacggg
aacatctacggtgtccacccattctacattgatcagagatacgccaacttgaatcagacc
aacgttcacaccacgcctctcaacgacactcgctttcctggagtgctgtggggcaaccag
agcaacagtaccgtctcactgtcgaattcgagcttctacgaggagtactctcctttgaac
aagtcttactctcatggtgtctggtggagaacatcggctcctcaggaggtcatcattgag
gaagaggctatcacttggagagctcttaatggagttattgatctttacttcttctctggt
cccactcctaaggatgtgatcaagcagtacgtctctgaagtcggaaagcctgctcttcag
ccctactgggccttgggctaccaccattctcgttggggctacagcacaatcgacgacttg
caaaatgtcgttgacacatttgctgaaaaggatcttcagctcgagaccatctggagtgat
attgactacatggactcgttcaaagatttcacgaacgaccctcacagatatcctcttgac
aagttcctgcatttccttgatcagcttcatgacggtgaccagcattatgttcccattgtc
gatgctgctatctactatcctaaccctaacaacaaaaccgacgccgactaccctgccttc
aatgatggcaataaaaccgatgtcttcttgaagaatcctgacggatccctctacattggc
gccgtttggcccggttatacagtgttccccgacttcttggccaacaacacttttgagtgg
tggaagaaaacattcaaagactggtacgagcagatcaagttcgatggtatttggcttgac
atgaacgaggtatcttctttctgtgtgggctcttgtggctcaggaaaagtggagaagaac
ccagtgcatgctccattccagtatggtggtcttcaggagcagttcccagaaggttttgcc
acaagcaacgctactgagtacaagcagttcttgcagttcatttcggcttcttcaaattct
tcctttagtgactcctcgaacgacactaaatcgtcttcagaagagttcttcaactggaaa
gctccaggtaagggcaacatcaactaccctccttatgtgatcaaccatgcacaaggcgat
catgacttggccacccacgcagtttcgccaaacgctactcatgctgacggcaccttagag
tacgatatccacaacttgtacgggtatcttcagaccaacgctacattccatgctcttcag
gatgttgccccaggtaaaagaccctttatcatttccagatccacctactctggctctggt
gcgtacgctggccattggggcggcgacaactggtccaactttacctacgcctacttctca
attccacaagctctcacgttgggtcttgctggaattcctttcttcggtgttgatatctgc
ggtttcaacggcaacagtgacttggagttgtgctcgagatggatgcaattgggtgccttc
ttcccattctaccgtaaccacaatgtcttgggtgccattgaccaggagccttacgtgtgg
gaggatgtgttgagtcattcgaaggtcaccatggatatccgctacgctcttcttccatac
ttttacaccttgttgcacgaggcctccgaaacaggtgttccacctttaagagcactctcg
tgggagttccctgacgacccagctctctctgatgccgacaggcaattctttgtgggcgag
gctcttttggtgactcccgttttggagcccaacgtgtccactgtcaagggtgtattccct
ggcgccaacgttaccgatgtctactacgattggtatactcacgagaaggccaacttcacc
gacggcaaaaacgagactttggacgcccctcttgggcatatccctcttcacatccgcggc
ggccacattatcccaatgcaagaccccggctacactgttgctgagtctagaaacaactcg
tggaacatcattgtgccgcttggaatcgagggcactgccagtggtctgttgtactacgac
gatggagactcttaccctattgtcaattccaccaccgttgactttgttgcttctgagggc
tctctctctgcttctgcttacggtgactacagaatcgagcagcctttgtcgagtgtttac
attttgggcgtggaagacgagcctaactctgtgaagttcaacggccagtcggtgagcttt
gagttcgccaacaatacgatcgaggtgactgagttggaggatctcacagagaagggcgcc
ttctaccgtgatttcacgcttacatggaattaa

DBGET integrated database retrieval system