KEGG   Campylobacter avium: CAV_0147Help
Entry
CAV_0147          CDS       T05533                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acp] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cavi  Campylobacter avium
Pathway
cavi00061  Fatty acid biosynthesis
cavi00780  Biotin metabolism
cavi01100  Metabolic pathways
cavi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cavi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CAV_0147 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CAV_0147 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cavi01004]
    CAV_0147 (fabZ)
Enzymes [BR:cavi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CAV_0147 (fabZ)
Lipid biosynthesis proteins [BR:cavi01004]
 Fatty acid synthase
  Component type
   CAV_0147 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT_2 4HBT
Motif
Other DBs
NCBI-ProteinID: ASQ29819
UniProt: A0A222MV79
LinkDB All DBs
Position
145613..146053
Genome map
AA seq 146 aa AA seqDB search
MMDAMQIQAILPHRYPFFLVDKITELKIGEVVRGYKNITINEQVFMGHFPGHPIYPGVLI
LEGMAQTGGVLAFESMEDKVNPKEKVVYFTGIDKAKFRNPVRPGDRLDYEMQVIKNRGNM
WIFQGKAFVDNALVAEAELKAMIMDK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgctatgcaaattcaagctatactaccacacagatacccattttttctagta
gataagattactgagctaaagattggtgaagtagtaagaggatataaaaatatcactata
aacgagcaagtttttatggggcattttccgggacaccctatatatcctggtgttttgata
cttgagggtatggcacaaacaggcggagttttagcctttgaaagtatggaagataaggta
aatcctaaggaaaaggtcgtgtattttacaggtatagacaaggcgaaatttagaaatcct
gtgcgtccgggcgataggcttgattatgaaatgcaagtgattaaaaacagaggcaatatg
tggatttttcaaggcaaagcctttgtagataatgctttggttgctgaagctgaactaaaa
gctatgataatggataagtaa

DBGET integrated database retrieval system