KEGG   Campylobacter avium: CAV_1248Help
Entry
CAV_1248          CDS       T05533                                 

Gene name
trpDG
Definition
(GenBank) anthranilate phosphoribosyltransferase / anthranilate synthase component II
  KO
K13497  anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
cavi  Campylobacter avium
Pathway
cavi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cavi01100  Metabolic pathways
cavi01110  Biosynthesis of secondary metabolites
cavi01130  Biosynthesis of antibiotics
cavi01230  Biosynthesis of amino acids
Module
cavi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cavi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CAV_1248 (trpDG)
Enzymes [BR:cavi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     CAV_1248 (trpDG)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CAV_1248 (trpDG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 GATase Peptidase_C26 Glycos_trans_3N DUF1936 DUF190
Motif
Other DBs
NCBI-ProteinID: ASQ30874
UniProt: A0A222MXL7
LinkDB All DBs
Position
1238310..1239923
Genome map
AA seq 537 aa AA seqDB search
MIVLIDNYDSFVFNIKTMLETVYKGEIKVLRNDACDIEYIKKLNPDFIILSPGPKHPKDS
GICLDIFKAKLEIPTLGICLGHQALAFCFDCEISRLKEPKHAITSSIDVLDEGLIFKNLP
KNFEVMRYHSLYVKEANENFTVLARSEDGCIMAIKHKHLPYFGIQFHPESYFSEYGLKIF
ENFLALKKDETKEKKQNLAYFINKMQDNEKLQSKDFELICKLIASKDYEPLQLSALLVLI
TEKSLDENSLSSLVKSVLKYSQTFSDESDMIDIVGTGGDGFKSINVSTSAAFILAALGVK
VAKHGNKAISSSSGSSDVLEALNIHSTSSILKQKKLLDETGLSFFHAPHFHSLVGEIKEI
RQRLGVRTVFNVLGPLLHPNLKLKYQLVGNYHAPVHELLIKVLKQLGRKKALVVRGNDGM
DEISICDDTKIYELNEGEISSYTISPEQFGFKRAMHYEIKGGNAKENARILLDTLEGKIS
GAKFDIVVLNAMFALYATQKVSNPLVAKEMILDAIYSGKVLEYFTKYQEKVSSINAN
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgctaattgataattacgattcctttgtttttaacataaaaacaatgcttgaa
accgtgtataaaggtgaaataaaagttctaagaaatgacgcttgcgatatagagtatata
aaaaaattaaatcctgattttatcatcctaagcccaggcccaaagcacccaaaagacagc
ggaatttgccttgatatatttaaagcaaaacttgaaattccaacccttggaatttgtctt
ggacatcaagctttagccttttgttttgactgcgaaatttcaagattaaaagagcctaaa
cacgccattacctcaagcatagatgtcctagatgagggactaatctttaaaaatttacca
aaaaactttgaggtgatgaggtatcattctttgtatgtgaaagaagctaatgaaaatttc
accgttttagcaagaagtgaagatgggtgtataatggctattaagcacaagcacttgccg
tattttggcatacagtttcatccagaaagttattttagtgagtatggactaaaaattttt
gaaaatttcttagccctcaaaaaagatgagacaaaagaaaaaaagcaaaatttagcttat
tttataaacaaaatgcaagataatgaaaaactgcaaagtaaggattttgagctaatatgc
aaactcatagcaagcaaagattacgagcccttgcagcttagtgccttgcttgtgctaatt
actgaaaaatccttggatgaaaattctctttcttctcttgtaaaatccgtacttaagtat
tctcaaacctttagtgatgaaagcgatatgatagatatagtaggcacaggaggcgatggc
tttaagagtataaatgtctctacaagcgcagcttttatacttgccgcacttggagttaag
gtggctaaacacggaaacaaggccatatcaagttcaagcggaagcagcgatgtgctagaa
gctttaaatatacacagcacatctagcattttaaagcaaaaaaagcttttagatgaaacg
ggtttgtcctttttccacgccccacattttcattctttagtaggagagataaaagaaatc
cggcaaagattaggagttagaactgtttttaatgttttaggtcccttgcttcacccaaat
ttaaaactaaaatatcaactagtgggcaattatcacgcaccggttcatgagctgcttata
aaagttcttaagcaacttggcagaaaaaaagcgctcgtagttcgcggaaatgacggaatg
gatgagattagcatatgcgatgatacaaaaatttatgagttaaacgaaggagaaattagc
tcctacaccataagccccgaacaatttggctttaaaagagctatgcattatgaaatcaaa
ggtggcaacgctaaagaaaacgctagaattttacttgacaccttagaaggcaagataagt
ggtgcaaaatttgatatagtcgtgctaaatgccatgtttgcactatatgcgacacaaaag
gtaagcaaccctttagtagcaaaggagatgattttggatgcaatttacagcggcaaggtc
ttagagtactttactaaatatcaagaaaaagtaagttctataaatgcaaattaa

DBGET integrated database retrieval system