KEGG   Carnobacterium inhibens: Q783_00665Help
Entry
Q783_00665        CDS       T02884                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
caw  Carnobacterium inhibens
Pathway
caw00010  Glycolysis / Gluconeogenesis
caw00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:caw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q783_00665
   00500 Starch and sucrose metabolism
    Q783_00665
Enzymes [BR:caw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Q783_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: AGY80895
UniProt: U5S6R2
LinkDB All DBs
Position
140401..141828
Genome map
AA seq 475 aa AA seqDB search
MTLTVEQFPKDFLWGGAVAANQLEGAYNADGKGWSVQDVTPQGGFGPITDEPTEDNMKLV
GIDFYNRYKEDIKLFAEMGFKTFRTSIAWSRIFPNGDEAEPNEAGLKFYDDLFDELLKYN
IEPLVTLSHYETPLHLAKEYDGWVNRKMIGFYENYVRTVFTRYKGKVKYWLTFNEINSIL
HAPFMSGGIATAPEKLTQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPL
TPNPDDVIAVMEAERKNYFFSDVHVRGTYPGYMKRFFRENAIELDFGPEDEELLKNTVDF
ISFSYYMSSTETADESKREAGKGNILGGIPNPYLEASEWGWQIDPKGLRIVLNDFWDRYQ
KPLFIVENGLGANDELIIDENGNKTVNDDYRIDYLNDHLVQVGEALKDGVEAMGYTTWGC
IDLVSASTAELKKRYGFIYVDRHDDGTGTLERYKKKSFSWYKEVIETNGTSLVEK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgactttgacagtagaacaatttccaaaagattttttgtggggtggagcagtagctgca
aaccaattagaaggagcttacaacgcagatggtaaagggtggtctgtccaagatgtaaca
cctcaaggcggatttggcccgataacggacgaaccgacagaagataacatgaaattagtc
gggattgatttttataaccgctataaagaagacattaaattatttgcagaaatgggattt
aaaacattccgtacgtcaattgcatggtctcgcatctttcctaatggagatgaagctgaa
ccaaatgaagctggattaaaattttacgatgatttatttgatgaacttcttaagtacaat
attgaaccattagtaacactatctcactatgaaacaccattacatttagccaaagaatac
gacggttgggttaatcgcaaaatgattggcttttatgaaaattatgtacgtactgtcttt
acacgctataaagggaaagtgaaatactggctgacctttaatgaaatcaattccatttta
catgcaccatttatgagtggtggaatagctactgcaccagaaaaattgacacaaaaagat
ttgtatcaagcggttcatcacgaattagtagcgagtgcattggctacaaaaatcgggcat
gaaattatgccggaagcacaaatcggatgtatggttttagctatgccgacatacccatta
actccaaacccagatgacgttattgctgtaatggaagcagagcgtaaaaactatttcttc
tcagatgtacatgttcgaggaacttatccagggtatatgaaacgatttttccgtgaaaat
gcgattgagttagattttggcccagaagatgaagagttgttgaaaaacacggtcgatttc
atttcatttagttattatatgagttctacagaaacagctgatgaaagcaaacgagaagct
ggtaaaggtaatattttaggcggtatccctaatccgtatttagaagcttcagaatggggc
tggcaaattgaccctaaaggattgcgaatcgtattaaatgatttctgggatcgttatcaa
aaaccattgtttattgttgagaatggtttaggagctaatgatgaactgattatagatgaa
aatggaaataaaactgtgaatgatgattaccgtatcgattacttgaatgatcatttggtc
caagttggagaagcccttaaagatggtgtagaagctatgggatacacaacttggggttgt
atcgatttagtcagtgcttcaacagcagaattgaaaaaacgttatggatttatttatgtt
gatcgtcatgatgatggaacaggtacattagagcgatataaaaagaaaagtttttcatgg
tataaagaagtcattgaaacaaatggaacaagtcttgttgaaaaataa

DBGET integrated database retrieval system