KEGG   Carnobacterium inhibens: Q783_05875Help
Entry
Q783_05875        CDS       T02884                                 

Definition
(GenBank) MarR family transcriptional regulator
  KO
K15973  MarR family transcriptional regulator, 2-MHQ and catechol-resistance regulon repressor
Organism
caw  Carnobacterium inhibens
Brite
KEGG Orthology (KO) [BR:caw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:caw03000]
    Q783_05875
Transcription factors [BR:caw03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    Q783_05875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 TrmB HTH_34 RuvB_C Penicillinase_R HTH_46 LexA_DNA_bind RA
Motif
Other DBs
NCBI-ProteinID: AGY81805
UniProt: U5S987
LinkDB All DBs
Position
complement(1225406..1225843)
Genome map
AA seq 145 aa AA seqDB search
MTDSTKALKTLTVLLKSSSSVQDVVKKDMIKYGLNSTEFSVLELLYNKGDQPIQYIGKKI
LLASSSITYVVDKLEKKGFIKRCPSATDRRVTNISISEKGTAFMQEAFPKHELLISELFN
VLNQEEMTTLTELLKKVGYHASSFN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacggattcaactaaagcattaaaaactttgacggtattattaaaatcttcttcaagt
gtccaagatgttgtgaaaaaagacatgataaaatatggtctaaattcaacagagttttca
gttttagaacttttatacaataaaggcgatcaacctatccaatatattggtaagaaaatt
ttattagccagcagcagtattacgtatgtcgtagataaattggaaaaaaaggggttcata
aaacgttgcccttcagctacggatagacgtgtaaccaatatttccatctctgaaaaaggg
acagcgtttatgcaagaagcttttccaaaacatgaattattgatttcagagttgttcaat
gtccttaatcaagaagaaatgactacattaacagaattattaaaaaaagtagggtatcat
gctagttcatttaactaa

DBGET integrated database retrieval system