KEGG   Corynebacterium atypicum: CATYP_01925Help
Entry
CATYP_01925       CDS       T03227                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cax  Corynebacterium atypicum
Brite
KEGG Orthology (KO) [BR:cax00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cax03012]
    CATYP_01925
   03029 Mitochondrial biogenesis [BR:cax03029]
    CATYP_01925
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cax04147]
    CATYP_01925
Translation factors [BR:cax03012]
 Eukaryotic Type
  Elongation factors
   CATYP_01925
 Prokaryotic Type
   CATYP_01925
Mitochondrial biogenesis [BR:cax03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CATYP_01925
Exosome [BR:cax04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CATYP_01925
  Exosomal proteins of breast cancer cells
   CATYP_01925
  Exosomal proteins of colorectal cancer cells
   CATYP_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIG63639
UniProt: A0A075TQA6
LinkDB All DBs
Position
411924..413114
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLAEKYPEENQAFAFDAIDKAPEEKE
RGITINISHVEYSTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEEAPIVHISALKAL
EGDEKWSQSIVDLMDACDESIPDPVRDVDHPFLMPIEDIFTITGRGTVVTGRVERGRLNV
NEDVEIIGIKDKSTSTTVTGIEMFRKMLDYTEAGDNCGLLLRGIKREDVERGQVVIKPGA
YTPHQEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNVD
MRVELIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaccaagccgcacgtcaacatcggcaccatcggtcac
gttgaccacggcaagaccaccaccacggctgctattaccaaggtgctggccgagaagtac
cccgaggagaaccaggccttcgctttcgacgccatcgacaaggcgccggaggagaaagag
cgtggcattaccattaacatctcccacgtcgagtactccaccccgaagcggcactacgct
cacgtcgacgcgccgggccacgccgactacatcaagaacatgatcaccggcgccgcccag
atggacggcgcgatcctggtggtcgccgcgaccgacggcccgatgccgcagacccgcgag
cacgtgctgctggcccgtcaggttggcgtgccctacatcctggtcgccctgaacaagtgc
gacatggtcgacgacgaagagatcatcgagctcgtcgagatggagatccgcgagctcctc
gcggagcaggattacgacgaagaggccccgatcgttcacatctccgcgctgaaggcgctg
gagggtgacgagaagtggagccagtccatcgtcgacctgatggacgcctgcgacgagtcc
atcccggatccggtccgcgacgttgaccacccgttcctgatgccgatcgaggacatcttc
accatcaccggccgcggcaccgtggtcaccggccgcgtcgagcgtggtcgtctgaacgtg
aacgaggacgtcgagatcatcggcatcaaggacaagtcgacctcgaccaccgtcaccggt
atcgagatgttccgcaagatgctggactacaccgaggctggcgacaactgcggtctgctg
ctccgcggcatcaagcgcgaggacgtcgagcgcggccaggtcgttatcaagccgggcgcc
tacaccccgcaccaggagttcgagggttccgtctacgttctgtccaaggacgagggcggc
cgccacaccccgttcttcgataactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgttgtccacctgccggagggcaccgagatggtcatgccgggcgacaacgtcgac
atgcgcgtcgagctgattcagccggtcgccatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgtgggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system