KEGG   Clostridium acetobutylicum EA 2018: CEA_G0085Help
Entry
CEA_G0085         CDS       T01864                                 

Definition
(GenBank) MutT/Nudix family hydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
cay  Clostridium acetobutylicum EA 2018
Brite
KEGG Orthology (KO) [BR:cay00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cay03400]
    CEA_G0085
Enzymes [BR:cay01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     CEA_G0085
DNA repair and recombination proteins [BR:cay03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    CEA_G0085
 Prokaryotic type
    CEA_G0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ADZ19128
LinkDB All DBs
Position
93049..93525
Genome map
AA seq 158 aa AA seqDB search
MDQLRYTICFIKREDEVLLLNREKPSWMGSWNGVGGKFQNSETPMECILREIHEETGMKF
QEAKFKGIVTWDEGDKDIGGMYLFLIEVPANYNYSVPVKTREGILDWKKISWVMNPENTG
IAANVPKYLPKMLKEEGEFRYHCVFKNKMLLGVNIEEI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacttaggtataccatttgttttataaaaagagaagatgaagtgcttctttta
aatagagaaaagcctagctggatgggaagttggaatggtgttggaggaaagtttcaaaat
agtgaaactccaatggaatgcatacttagagagatacatgaagagacaggaatgaagttt
caagaggccaaatttaaaggcatagttacatgggatgaaggagataaagatattggtggc
atgtatctttttttgatagaggttcctgcaaattataattattctgtaccagtaaaaaca
cgagaagggattttagattggaaaaagatatcttgggtaatgaatcctgaaaatactgga
attgcagcaaatgtacctaaatatcttcctaagatgcttaaggaagaaggcgaatttaga
tatcattgtgtttttaaaaataaaatgcttctaggggttaacatagaagagatttga

DBGET integrated database retrieval system