KEGG   Clostridium acetobutylicum EA 2018: CEA_G0252Help
Entry
CEA_G0252         CDS       T01864                                 

Definition
(GenBank) Conserved membrane protein, predicted permease
  KO
K07090  uncharacterized protein
Organism
cay  Clostridium acetobutylicum EA 2018
Brite
KEGG Orthology (KO) [BR:cay00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CEA_G0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ADZ19293
LinkDB All DBs
Position
277368..277730
Genome map
AA seq 120 aa AA seqDB search
MSEFIIYAVIGIVAGVLSGLFGIGGGVVIIPALVMFAGFSQIKAQGTSLIAMLPPVGIFA
FMQYYKKGNTDIYAGIVICIAMVIAARFGGQLANILPVSVLKKAFGVFIILVGIKTIFGK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagtttataatctacgcagtaattggaattgttgctggtgttttaagtggtttg
tttggtataggtggaggagtagtaataattccggcgttagtaatgtttgcagggttttca
caaataaaagcacagggaacatctcttattgcaatgcttccaccagttggtattttcgca
tttatgcagtattacaaaaagggaaatacggatatatatgcgggaatagttatttgtata
gctatggttatagcggctagatttggagggcagcttgcaaacatacttccggtgagtgta
cttaaaaaggcatttggagtatttattatattagttggtataaagaccatttttggaaaa
tag

DBGET integrated database retrieval system