KEGG   Clostridium acetobutylicum EA 2018: CEA_G1377Help
Entry
CEA_G1377         CDS       T01864                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase, Cu-Zn family
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cay  Clostridium acetobutylicum EA 2018
Brite
Enzymes [BR:cay01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CEA_G1377 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ADZ20414
LinkDB All DBs
Position
1507956..1508504
Genome map
AA seq 182 aa AA seqDB search
MYFDEYQCPFLDNYDYEHRENEDLYRQAPRRAVATIVGGPLAPNIRGTVTFTSVPNGTEV
SVVLNGLPPYRPAMGGRPQVGPHGFHIHQNGNCTPGTAAQPFPGTGEHWNPTNQPHGNHA
GDFPVVFSNNGYARMTFFTNKFRVPQVIGKSVVLHESPDDYRTQPAGASGRKVACGVIRA
VR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgatgaataccaatgtccttttttagacaattatgattatgaacacagagag
aacgaggatttgtacaggcaagcaccaagaagagctgtagcaactatagtaggaggacca
ttagctcctaatattagaggaactgtaacatttacaagtgtacctaacggaacagaggtc
tctgttgtgcttaatggactgccaccgtatagaccagcaatgggtggaagacctcaggtt
ggacctcatggatttcacatacatcaaaatggtaattgtactccaggaactgcagcacag
ccttttccaggcactggggaacattggaacccaactaatcaaccacatggaaaccatgca
ggagattttcctgtagttttttctaataatggatatgctagaatgacattctttacgaat
aaatttagggtcccacaagtcataggaaaatctgtagtattgcatgaaagtccagacgat
tataggacacaaccagcaggagcatctgggagaaaagtagcgtgtggtgttattagagct
gttagataa

DBGET integrated database retrieval system